DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13676 and CG13643

DIOPT Version :8

Sequence 1:NP_648179.3 Gene:CG13676 / 38906 FlyBaseID:FBgn0035844 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_001262937.1 Gene:CG13643 / 50074 FlyBaseID:FBgn0040601 Length:819 Species:Drosophila melanogaster

Alignment Length:817 Identity:166/818 (20%)
Similarity:260/818 (32%) Gaps:278/818 (34%)


  Fly   123 MDEIHFKCEGLHD----GFYASIEYKCQIYHHCV----YGIRH-------------DFLCANFTA 166
            |.:..|.|   ||    |:||..|.:||::|.||    .|:.|             .|||.|.||
  Fly    49 MPKTQFTC---HDKILGGYYADPETQCQMFHVCVKLPGVGLLHRRANPFVQQVQDYRFLCPNTTA 110

  Fly   167 FDQRTFICHFASDVDCEGSQKYWNRN--DELYMATTTTSTSTTTTPAPPTLPPAP---------- 219
            |||...||....||||:.:..:::..  ::|| .....|.|.....|...|..|.          
  Fly   111 FDQELQICANWLDVDCDKATSFYDNGHLNDLY-RNGDESKSANEEEATFHLQRAETGDIRRSKEN 174

  Fly   220 ---------RRRPQRPQRPLRRPY--------------------NRRPIDDYY------------ 243
                     |...|:|:.  |..|                    .:|||..||            
  Fly   175 HNNNNINNNRGADQKPRH--RHNYAQTGGSSSSSSSPKLEITQSTKRPISTYYTPTTLGSTTTST 237

  Fly   244 YEDQDQYEDDYYEERPVRRPKPRPRQRKPQVEPEYDDEY---DDKRTEAKKPIRRNRNRYRDEEE 305
            .......|..||..                   .|::.|   ||.:.:.....:.:.:.:.....
  Fly   238 TSTTTTTERSYYNN-------------------NYNNNYSNNDDSKQDLDDIFKGSHSSHFFSNR 283

  Fly   306 ALDEDYDERPSK-RP----------------RG--KPTAGTAG---------------RKI---- 332
            ....:|||.||: :|                ||  :||:|::.               :||    
  Fly   284 HGGREYDEEPSRPKPNDFSDYQRKTTRVTPTRGVQRPTSGSSSPIPSSTAAPSTTKSLKKITLHA 348

  Fly   333 ----------------------SPRKPGRVEERRSFNEDRPLGRRRSE-------------KERT 362
                                  :||....:..|.||..:....:.|.:             |..:
  Fly   349 TFNTDFLDSSSHTKSPSYSAVTTPRPSSSITSRFSFGSNDFSTQERIQPTTYNPNNGAYRFKTTS 413

  Fly   363 TPSSA-------LDDLDEYEKPYNSA--------------------DQVEAAEEQTPQK---VKT 397
            .|:|:       :.|.::..||.::|                    |..::.:.|.||.   .:|
  Fly   414 PPASSTKVTGKGVQDFEKRSKPTSAAVRKQKLGPQESNFINQNEFVDLSKSTKLQQPQPFQVAQT 478

  Fly   398 TPKPLTEFITPKAAAASVYARPRAPPRIARPVPINEKKKFSYPVQKITATTQAPSNSAQEEEDYP 462
            .|..|...          |.|.:  |::.| |...|...||.|..|..:.|   |..:...:...
  Fly   479 KPNQLEPH----------YQRHK--PQVTR-VGGQEPAPFSAPSSKPRSFT---SRGSITYKATT 527

  Fly   463 EEQVEEDYEQPPARNTPRRRTPASRAEQKPTRTTLRKPVTDKKPVDEEYDEPAEPEPLRKRKRPL 527
            |..|:::...|...:|       :||::..|.||.| |.|.|||.::.|.......|.:...:..
  Fly   528 ERYVDQELYYPTTSST-------TRAKEAYTPTTFR-PTTYKKPYEQSYQSQQTHRPTQAATKKA 584

  Fly   528 A-------PRSRVPAADVDFEDEEYE----ESPAPVSTAAPLRNQRLRAKT-TTRKPTAPPRPRK 580
            |       |.:..|.|:||.:|.:|.    |:..|.:....|||:...:.| ||..|....|...
  Fly   585 AHSVTSAPPTTTNPHANVDEDDGQYHPELYENDFPRNRIRFLRNRSTSSTTSTTSAPVVSSRQPH 649

  Fly   581 PIVEDEEELEHPVEAV---EDEAPAPRSRANSLSGR----------NAGAGFSQRPSSVRVVKRP 632
            ...:....|:...::|   |.|....|.|.:.||..          |.||. |.......:.|..
  Fly   650 GFQQAHHHLKSQQQSVYQKERERERERERESDLSDEDELFKTAQSLNFGAA-SINKLRADIYKAE 713

  Fly   633 FLPSRGGSPYLPRGLQPVGVALKPLPTTDSTPIDMGSTISGVRLLEHGAPLLRGNPDSGEDDEED 697
            ....:..|.|.|:.......:.....:|.:|.....:|.:..|                      
  Fly   714 KTSQQYNSQYSPQLASSPQASSSSSSSTSTTSTTTSTTTTTTR---------------------- 756

  Fly   698 APPSPSPPRTTLPPRSALPA-TPKRVEPQRPKLNLDE 733
            .||:.....||....||.|. |.|.|:.::.:..|::
  Fly   757 RPPTTVRTTTTTFTTSAPPVETKKSVKSKKEQQQLEK 793

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13676NP_648179.3 CBM_14 130..182 CDD:279884 28/73 (38%)
CG13643NP_001262937.1 CBM_14 63..126 CDD:279884 25/63 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.