DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13676 and CG12009

DIOPT Version :8

Sequence 1:NP_648179.3 Gene:CG13676 / 38906 FlyBaseID:FBgn0035844 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_647799.1 Gene:CG12009 / 38405 FlyBaseID:FBgn0035430 Length:905 Species:Drosophila melanogaster

Alignment Length:785 Identity:177/786 (23%)
Similarity:267/786 (34%) Gaps:283/786 (36%)


  Fly    15 LLLLSLLASTDAALPFKKVSIAKTPVSTSSTTSTTTEAPAVEEEEVEEEQPVPTADSSDGSKSDN 79
            |.||.||.:|.:|.|.......|.||:.........|.|  |:.|.|:|:....|.|.       
  Fly     5 LCLLLLLTATCSAGPLSAHQKRKAPVTREEPVPAEVEMP--EQTETEDEEAPAEAASM------- 60

  Fly    80 GTLLKNSKLTGIPQIDYIWDPNLPRELRGYNLSTYPFLSTVPPMDEIHFKCEGLHDGFYASIEYK 144
            |||...|..|.| :.| |.|                           :|.|.....|:||.:|..
  Fly    61 GTLTLPSNATSI-RSD-ITD---------------------------NFSCVNKTYGYYADVEND 96

  Fly   145 CQIYHHCV---YG------IRHDFLCANFTAFDQRTFICHFASD--VDCEGSQKYWNRNDELYMA 198
            |||:|.|:   |.      .|..|:|...|.|.|.:|.|....|  ::||.|.:|:..|...   
  Fly    97 CQIFHVCLPVTYADGRENTFRWSFICPEETIFSQESFTCMRREDMTIECEDSSRYYELNGNF--- 158

  Fly   199 TTTTSTSTTTTPAPPTLPPAPRRRPQRPQRPLRRPYNRRPIDDYYYEDQDQYEDDYYEERPVRRP 263
                              ..|.....:|          .|::.   |:.::.|.:         |
  Fly   159 ------------------GGPAEEESKP----------TPVES---EEPEKEESE---------P 183

  Fly   264 KPRPRQRKPQV--EPEYDDEYDDKRTEAKKPIRRNRNRYRDEEEALDEDYDERPSKRPRGKPTAG 326
            :|.|.:.:|::  |||         .:..||:                    :|.|..:.||   
  Fly   184 EPEPVESEPEIPAEPE---------VQTAKPM--------------------KPVKAQKPKP--- 216

  Fly   327 TAGRKISPRKPGRVEERRSFNEDRPLGRRRSEKERTTPSSALDDLDEYEKPYNSADQVEAAEEQT 391
                                      .||:.:.:|..|:..           .:|.:|||..|.:
  Fly   217 --------------------------NRRKPQPQRKVPAVV-----------TAAPEVEAIPEPS 244

  Fly   392 PQKVKTTPKPLTEFITPKAAAASVY-ARPRAP-PRIARPVPINE-----KKK---FSYPVQKITA 446
             ..|:..||||    .|:...:..: .||:.. |.||.|...||     :|:   |:.|     .
  Fly   245 -APVEMEPKPL----KPQRFTSRPHQERPQVKRPAIAAPPMRNELFNGIRKRPAIFNKP-----P 299

  Fly   447 TTQAPSNSAQEEEDYPEEQVEEDYEQPPARNTPRRRTPASRAEQKPT---RTTLRKPVTDKKPVD 508
            ||..|              |||..|..||..    ......:|.:||   :|...:|......|.
  Fly   300 TTVKP--------------VEEVVENEPAVT----EAVVQLSEPQPTLKLQTLFAEPEVIPVEVQ 346

  Fly   509 E---EYDEPA----EPEPLRKRKRPLAPRSRVPAADVDFED----EEYEESPAP-VSTAAPLRNQ 561
            |   :..|||    :|||:.:...|    |:| ..|...||    |..||.||. |.:....|.|
  Fly   347 EPEVQASEPAVTFVQPEPVVEEVVP----SKV-EIDTRIEDVKPIEAIEEIPAVIVESLDQSRPQ 406

  Fly   562 RLR--AKTTTR--KPTAPPRPRKPIVEDEEELEHPVEAVEDEAPAPRSRANSLSGRNAGAGFSQR 622
            .::  ||.|..  ||...|:|       |||::...|...:||..|.              ...:
  Fly   407 EMQEEAKITEEEAKPEEEPKP-------EEEVKLEEELKSEEAAKPE--------------VELK 450

  Fly   623 PSSVRVVKRPFLPSRGGSPYLPRGLQPVGVALKPLP-TTDSTPIDMGSTISGVRLLEHGAPLLRG 686
            |..::..:.|.:|::            |...::..| ...|.|..|..:.|      |..||:  
  Fly   451 PQEIQAQEEPEVPAK------------VEEIIEANPEEIKSEPAIMEVSNS------HEEPLV-- 495

  Fly   687 NPDSGEDDEEDAPPSPSPPRTTLPPRSALPATPKRVEPQRPKLNLDELYENDYDVTLNDALDPTL 751
                ..:..|.|.|:.:|        .::||||: :|...|.  ::|:.:|..|....::|. ..
  Fly   496 ----NLEALEAAKPADAP--------ESMPATPE-MEQHSPL--VEEILDNTNDGEAQESLG-GF 544

  Fly   752 KPLSP 756
            ||:.|
  Fly   545 KPVDP 549

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13676NP_648179.3 CBM_14 130..182 CDD:279884 20/63 (32%)
CG12009NP_647799.1 CBM_14 82..145 CDD:279884 20/63 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.