DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ldbr and DBR1

DIOPT Version :8

Sequence 1:NP_996022.1 Gene:ldbr / 38900 FlyBaseID:FBgn0035838 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_012773.1 Gene:DBR1 / 853708 SGDID:S000001632 Length:405 Species:Saccharomyces cerevisiae

Alignment Length:421 Identity:155/422 (37%)
Similarity:227/422 (54%) Gaps:64/422 (15%)


  Fly     1 MKIAVEGCAHGELERIYDTIEGIEKVGGTKIDLLLCCGDFQSTRNLEDLQTMAVPKKYLDMCSFY 65
            ::|||:||.||:|.:||..:..|.  ..|.||||:..|||||.|:.:|.:::|:|.||..:..|.
Yeast     4 LRIAVQGCCHGQLNQIYKEVSRIH--AKTPIDLLIILGDFQSIRDGQDFKSIAIPPKYQRLGDFI 66

  Fly    66 KYYSGELVAPVLTIFIGGNHEASNYLQELPYGGWVAPNIYYLGYAGVVNVNGVRIAGISGIFKGH 130
            .||:.|:.|||.|||||||||:..:|..||:||:||.||:|:||:.|:...|:||..:|||:|..
Yeast    67 SYYNNEIEAPVPTIFIGGNHESMRHLMLLPHGGYVAKNIFYMGYSNVIWFKGIRIGSLSGIWKEW 131

  Fly   131 DFLRGHHEFPPYTD-------STCRSVYHVRQLEVFRLKQISGRVDIFLSHDWPTGIYEYGNKAQ 188
            ||   :.:.|.:.|       :..|::||||..::..|..|..|:||.||||||.|:..:|:...
Yeast   132 DF---NKQRPDWNDLENNNWKANIRNLYHVRISDIAPLFMIKHRIDIMLSHDWPNGVVYHGDTKH 193

  Fly   189 LLRKKPFFAADMESGKLGSQPLEELLKAVQPAYWFAAHLHCKFAALVPHNHSQKLGDAESSSSS- 252
            ||:.||||..|::.|||||....:||:.::|.:|.:||||.:|.|.:.||........:|:|.: 
Yeast   194 LLKLKPFFEQDIKEGKLGSPVTWQLLRDLRPQWWLSAHLHVRFMASIKHNKRSHEPPNKSTSKTK 258

  Fly   253 ----------SSSEDE-------DEEREKVKKAAPVPPPSKSVPVTKFLALDKCLPRRAFLQVVE 300
                      ||.|||       .||.|...|...          |:|||||||||||.:|:::|
Yeast   259 KNNNEIDLDLSSDEDERSGIMNCQEENEYDSKYGE----------TRFLALDKCLPRRRWLEILE 313

  Fly   301 VPSDPIEGT-----PRLEYDAEW---LAILHSTNHLISVKE----NYYYL--PGKKAGEFTERSN 351
            :..|....:     .|:.:|.|:   |.|.....:|:|.|.    |:..|  ..::.|...:..|
Yeast   314 IEPDTSHASWKDENHRMFWDPEFINNLVICQKNKNLLSNKPFNSVNWIELSQSNREEGRDIDWEN 378

  Fly   352 FTPTEEELEAVTAKFQKLQVPENFERTVPAF 382
            :.     :.|.|...||.:|     |...||
Yeast   379 YA-----IPAYTLDIQKDEV-----RQTKAF 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ldbrNP_996022.1 Metallophos 1..229 CDD:278574 105/235 (45%)
MPP_Dbr1_N 3..296 CDD:277322 132/318 (42%)
DBR1 281..416 CDD:282819 35/117 (30%)
DBR1NP_012773.1 MPP_Dbr1_N 6..309 CDD:277322 132/318 (42%)
DBR1 293..>354 CDD:309930 23/71 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C230962716
eggNOG 1 0.900 E1_KOG2863
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 252 1.000 Inparanoid score I653
Isobase 1 0.950 0 Normalized mean entropy S1349
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004436
OrthoInspector 1 1.000 T1136642
orthoMCL 1 0.900 OOG5_128259
Panther 1 1.100 LDO PTHR12849
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R294
TreeFam 1 0.960
1211.730

Return to query results.
Submit another query.