DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ldbr and dbr1

DIOPT Version :8

Sequence 1:NP_996022.1 Gene:ldbr / 38900 FlyBaseID:FBgn0035838 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_988947.1 Gene:dbr1 / 394544 XenbaseID:XB-GENE-5851881 Length:534 Species:Xenopus tropicalis

Alignment Length:581 Identity:254/582 (44%)
Similarity:332/582 (57%) Gaps:97/582 (17%)


  Fly     1 MKIAVEGCAHGELERIYDTIEGIEKVGGTKIDLLLCCGDFQSTRNLEDLQTMAVPKKYLDMCSFY 65
            ||||||||.||||::||:||:.:||...||:||||||||||:.||..|::.||||:||..|.:||
 Frog     1 MKIAVEGCCHGELDKIYETIQFLEKKENTKVDLLLCCGDFQAVRNEGDMKCMAVPQKYRQMQTFY 65

  Fly    66 KYYSGELVAPVLTIFIGGNHEASNYLQELPYGGWVAPNIYYLGYAGVVNVNGVRIAGISGIFKGH 130
            ||||||.:||:||||||||||||||||||||||||||||||:||||||...||||.|||||||.|
 Frog    66 KYYSGEKLAPILTIFIGGNHEASNYLQELPYGGWVAPNIYYVGYAGVVKYRGVRIGGISGIFKSH 130

  Fly   131 DFLRGHHEFPPYTDSTCRSVYHVRQLEVFRLKQISGRVDIFLSHDWPTGIYEYGNKAQLLRKKPF 195
            |:.:||.|.|||:..|.||.||||.:|||||||:...:|||:|||||..||.||||.|||:||.|
 Frog   131 DYRKGHFERPPYSKDTVRSAYHVRNIEVFRLKQLKEPMDIFMSHDWPRSIYHYGNKKQLLKKKDF 195

  Fly   196 FAADMESGKLGSQPLEELLKAVQPAYWFAAHLHCKFAALVPHNHSQKLGDAESSSSSSSSEDEDE 260
            |..::|:..|||....|||..:||:|||:||||.||||.:.|              .::.|.|  
 Frog   196 FRQEVENNTLGSPAASELLLHIQPSYWFSAHLHVKFAAFMQH--------------QTNVEGE-- 244

  Fly   261 EREKVKKAAPVPPPSKSVPVTKFLALDKCLPRRAFLQVVEVPSDPIEGTPR-LEYDAEWLAILHS 324
                :.||            |||||||||||.|.|||:|:|..||  |.|. ||||.||||:|.:
 Frog   245 ----IPKA------------TKFLALDKCLPHREFLQIVDVEHDP--GKPDCLEYDLEWLAVLKA 291

  Fly   325 TNHLISVKENYYYLPGKKAGEFTERSNFTPTEE-ELEAVTAKFQKLQVPENFERTVPAFDPAEQS 388
            |..|:::....:.:|....  ...|.:|:.:|: :.|.:......:::|.||..|...:|| ...
 Frog   292 TKDLLNITSKTWNMPENNG--LHSRWDFSASEKTKREILDDLGHDIKIPCNFCMTTACYDP-NNP 353

  Fly   389 DYK----HMFVDQPKVQLNPQSNTFCATLGIDDPLCLVL---------LANGLDLPAVGATE--- 437
            .||    |:        :|||:..|||.||:.|....:.         :....:..::|:.|   
 Frog   354 QYKRVATHI--------VNPQTTEFCARLGLVDLNAKIRQHEEEGDIDITEDNEADSIGSAEDPG 410

  Fly   438 --CKDRETKSSKLQ----AVEED-------VAEPLVTPTK-------------RKLNLSLPAPTT 476
              ..|....|:.:.    |:|:|       :||.|..|:.             |.|..|:...:.
 Frog   411 EYSTDTSLLSTSINPDEIALEDDDDQEDEGMAEKLGEPSPDYTPDLSINFSNIRVLPDSMAVSSD 475

  Fly   477 AAADTTDENVIDLPEEEAEEAIIATETPHVEEPASVPASPNVK---KLKRRNQNIYQAQED 534
            .|.|:|::. :|..|....|.    |......|....::.|..   |:|||||.||||::|
 Frog   476 DATDSTNDE-LDRSESSQTEG----EGKQSNRPLKRMSNENGSGGVKIKRRNQAIYQAKDD 531

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ldbrNP_996022.1 Metallophos 1..229 CDD:278574 156/228 (68%)
MPP_Dbr1_N 3..296 CDD:277322 176/293 (60%)
DBR1 281..416 CDD:282819 54/141 (38%)
dbr1NP_988947.1 Metallophos 1..229 CDD:278574 156/228 (68%)
MPP_Dbr1_N 3..264 CDD:277322 176/293 (60%)
DBR1 246..376 CDD:282819 56/155 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C230941784
eggNOG 1 0.900 E1_KOG2863
Hieranoid 1 1.000
Homologene 1 1.000 H9428
Inparanoid 1 1.050 419 1.000 Inparanoid score I1660
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1047278at2759
OrthoFinder 1 1.000 FOG0004436
OrthoInspector 1 1.000 T1060835
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R294
TreeFam 1 0.960
1110.790

Return to query results.
Submit another query.