DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Arp3 and Actl11

Sequence 1:NP_001261559.1 Gene:Arp3 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_080614.1 Gene:Actl11 MGIID:1914972 Length:1207 Species:Mus musculus

Alignment Length:404 Identity:111/405 (27%)
Similarity:176/405 (43%) Gaps:63/405 (16%)


  Fly     4 RLPACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEAFD 68
            ::.|.|||.|||::|.|.|.......::||.:.:.:....|...             ::..|..:
Mouse   857 KMAAIVIDTGTGFTKCGLAQENHVLSVVPSQVQMLQHPPQGQPQ-------------YVVPEHQE 908

  Fly    69 ATGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFET 133
            .: ||:   :..|:|.|||.:|...:...:..|:.:||:...|:.:.|::...|||..|||:||.
Mouse   909 GS-YSV---LNRGVVSDWDALEVLWQHLFYCKLKVQPEEMAVLVADSPISPRTNREKVAEILFER 969

  Fly   134 FNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGR 198
            |:||.:....||:|.|       .|..|| ||:||.||.|.::|.|:..|.:.......:.:||.
Mouse   970 FHVPAMQTVHQALLTL-------YAYGRT-TGLVVGSGHGTSYVAPIITGDLAPIDTYRLDVAGA 1026

  Fly   199 NITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFAKYDTEPGKWIRNFSGVNTVT 263
            ::|.::..||......:|....:   :.|||..||:..|.|.|.|          ||.|.|....
Mouse  1027 DLTDYLTQLLLSGGHSLPKGGII---RQIKEACCYVAMDTATEMA----------RNQSQVQVDF 1078

  Fly   264 KAPFN--VDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNIVLSGGST 326
            ..|..  :.:|.|||..||..|.|.....: .:.|.::....|....:..:..|..|:||.||||
Mouse  1079 VLPDKHVITLGSERFCCPEALFQPNLLGLN-QLGLPQLALLSINRLEVKQQEQLLANVVLEGGST 1142

  Fly   327 MFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFY 391
            :...|..|::::              |..|        ..|:....:..|.|.|||::|....|.
Mouse  1143 LINGFPERMRQE--------------LGPG--------ATVLGSPHRAVAAWLGGSIMACRDSFQ 1185

  Fly   392 QVCHTKAAYEEYGP 405
            .:..|:..|||.||
Mouse  1186 SLWLTRREYEEEGP 1199

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 111/405 (27%)
COG5277 6..410 CDD:227602 111/403 (28%)
Actl11NP_080614.1 Actin 860..1205 CDD:278451 111/402 (28%)
NBD_sugar-kinase_HSP70_actin 860..1204 CDD:302596 111/402 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.