DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Arp3 and ACTR3B

Sequence 1:NP_001261559.1 Gene:Arp3 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_065178.1 Gene:ACTR3B HGNCID:17256 Length:418 Species:Homo sapiens

Alignment Length:418 Identity:333/419 (79%)
Similarity:374/419 (89%) Gaps:0/419 (0%)


  Fly     1 MAGRLPACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDE 65
            |||.||.||:|.||||:|||:|||.||||||||.|||:|||:|.|...||:.:|::|||||||||
Human     1 MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDE 65

  Fly    66 AFDATGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIM 130
            |.|...|:.|:|:|||::|||||||||:||.|||||||||||||||:|||||||||||||.||||
Human    66 AIDKPTYATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIM 130

  Fly   131 FETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPI 195
            ||:||||||||||||||||||||.||...||||||||:|||||||||||||||||||||||||||
Human   131 FESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPI 195

  Fly   196 AGRNITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFAKYDTEPGKWIRNFSGVN 260
            |||:||.|||.||||||||||||||||||||||||:|||||||.|||||||.:|.|||:.::|:|
Human   196 AGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPRKWIKQYTGIN 260

  Fly   261 TVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNIVLSGGS 325
            .:.:..|.:||||||||||||||||||:||||...:|::||.||||||||||||||.|:||||||
Human   261 AINQKKFVIDVGYERFLGPEIFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYKNVVLSGGS 325

  Fly   326 TMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTPEF 390
            |||:|||||||||:||.||.|||:||.||.|||||||::|||:||||||||||||||||||||||
Human   326 TMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLASTPEF 390

  Fly   391 YQVCHTKAAYEEYGPSICRHNPVFGTMT 418
            :||||||..||||||||||||||||.|:
Human   391 FQVCHTKKDYEEYGPSICRHNPVFGVMS 418

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 331/415 (80%)
COG5277 6..410 CDD:227602 322/404 (80%)
ACTR3BNP_065178.1 Actin 2..417 CDD:330363 331/415 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5277
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 724 1.000 Inparanoid score I612
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D286999at33208
OrthoFinder 1 1.000 FOG0002014
OrthoInspector 1 1.000 T608888
orthoMCL 1 0.900 OOG5_128269
Panther 1 1.100 O PTHR11937
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R83
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.