DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Arp3 and Actrt2

Sequence 1:NP_001261559.1 Gene:Arp3 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001013959.1 Gene:Actrt2 RGDID:1359657 Length:377 Species:Rattus norvegicus

Alignment Length:409 Identity:123/410 (30%)
Similarity:200/410 (49%) Gaps:54/410 (13%)


  Fly     6 PACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEA-FDA 69
            |:.:.|.|:|..|.|.:|...|:.:..|.        ||....:....|.....:|:|:|| |..
  Rat    10 PSVIFDNGSGLCKAGLSGEIGPRHVTSSV--------VGYPKFKASPTGACQKKYFVGEEALFKQ 66

  Fly    70 TGYSIKYPVRHGLVEDWDLMERFLEQCVFKY-LRAEPEDHYFLLTEPPLNTPENREYTAEIMFET 133
            ....::.|:..||:..||.:|: |.:.:|:: |..:|.:...|:|||.||..||||.|||:||||
  Rat    67 ETLRLQSPIERGLITSWDDIEK-LWRHLFEWELGVKPSERPVLMTEPSLNPRENREKTAEVMFET 130

  Fly   134 FNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGR 198
            |.||..|::.||||||.:|        ..:||:|||||||||..:|:.|||.:...:..:.:||:
  Rat   131 FEVPAFYLSDQAVLALYSS--------ACVTGLVVDSGDGVTCTVPIFEGYSLPHAVSKLFVAGK 187

  Fly   199 NITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFAKYDTEPGKWIRNFSGVNTVT 263
            :||..:..||.......|..........||||.||:..:..:|.:          |....|....
  Rat   188 DITELLTRLLLASGRAFPCPLDKALVDDIKEKLCYVALEPEEELS----------RRAEDVLREY 242

  Fly   264 KAPFN--VDVGYERFLGPEIFFHPE---FSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNIVLSG 323
            |.|..  :.:|.:.:..||:.|.|:   ...|.    |:::..|.|..|..|:::.|:..|||||
  Rat   243 KLPDGNVIYIGDQLYQAPEVLFSPDQLGTHGPG----LAQMASNSIAKCDADIQKTLFGEIVLSG 303

  Fly   324 GSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTP 388
            |||:|:....||.::::                ::..|.:.:::.....:.::.|.|.|::.|..
  Rat   304 GSTLFQGLDDRLLKELE----------------QLASKGVPIKITAPPDRWFSTWIGASIVTSLS 352

  Fly   389 EFYQVCHTKAAYEEYGPSI 407
            .|.|:..|.|.::|:|.|:
  Rat   353 SFKQMWITAADFKEFGVSV 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 123/410 (30%)
COG5277 6..410 CDD:227602 123/410 (30%)
Actrt2NP_001013959.1 NBD_sugar-kinase_HSP70_actin 6..377 CDD:302596 123/410 (30%)
ACTIN 10..377 CDD:214592 123/410 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.