DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Arp3 and act-1

Sequence 1:NP_001261559.1 Gene:Arp3 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_505819.1 Gene:act-1 WormBaseID:WBGene00000063 Length:376 Species:Caenorhabditis elegans

Alignment Length:419 Identity:154/420 (37%)
Similarity:216/420 (51%) Gaps:61/420 (15%)


  Fly     7 ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEAFDATG 71
            |.|:|.|:|..|.||||:..|:.:.||.        ||....:.:..|:...|.::||||....|
 Worm     8 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEAQSKRG 64

  Fly    72 -YSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFETFN 135
             .::|||:.||:|.:||.||:......:..||..||:|..||||.|||...|||...:|||||||
 Worm    65 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 129

  Fly   136 VPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRNI 200
            .|.:|:|:||||:|.||       .|| ||:|:||||||||.:|:.|||.:...|..:.:|||::
 Worm   130 TPAMYVAIQAVLSLYAS-------GRT-TGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDL 186

  Fly   201 TSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFA----------KYDTEPGKWIRN 255
            |.::..:|.||..........|..:.||||.||:..|..:|.|          .|:...|:.|  
 Worm   187 TDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVI-- 249

  Fly   256 FSGVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNIV 320
                          .||.|||..||..|.|.|...: :..:.|...|.|..|.||:|:.||.|.|
 Worm   250 --------------TVGNERFRCPEAMFQPSFLGME-SAGIHETSYNSIMKCDIDIRKDLYANTV 299

  Fly   321 LSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLA 385
            ||||:||:.....|:|::|.                .:.|..:.:::|....::|:||.|||:||
 Worm   300 LSGGTTMYPGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILA 348

  Fly   386 STPEFYQVCHTKAAYEEYGPSICRHNPVF 414
            |...|.|:..:|..|:|.||||. |...|
 Worm   349 SLSTFQQMWISKQEYDESGPSIV-HRKCF 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 154/420 (37%)
COG5277 6..410 CDD:227602 152/414 (37%)
act-1NP_505819.1 PTZ00281 1..376 CDD:173506 153/418 (37%)
ACTIN 6..376 CDD:214592 153/418 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.