DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Arp3 and Actb

Sequence 1:NP_001261559.1 Gene:Arp3 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_031419.1 Gene:Actb MGIID:87904 Length:375 Species:Mus musculus

Alignment Length:421 Identity:153/422 (36%)
Similarity:217/422 (51%) Gaps:61/422 (14%)


  Fly     5 LPACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEAFDA 69
            :.|.|:|.|:|..|.||||:..|:.:.||.        ||....:.:..|:...|.::||||...
Mouse     5 IAALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEAQSK 61

  Fly    70 TG-YSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFET 133
            .| .::|||:.||:|.:||.||:......:..||..||:|..||||.|||...|||...:|||||
Mouse    62 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

  Fly   134 FNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGR 198
            ||.|.:|:|:||||:|.||       .|| ||||:||||||||.:|:.|||.:...|..:.:|||
Mouse   127 FNTPAMYVAIQAVLSLYAS-------GRT-TGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGR 183

  Fly   199 NITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFA----------KYDTEPGKWI 253
            ::|.::..:|.||..........|..:.||||.||:..|..:|.|          .|:...|:.|
Mouse   184 DLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVI 248

  Fly   254 RNFSGVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNN 318
                            .:|.|||..||..|.|.|...: :..:.|...|.|..|.:|:|:.||.|
Mouse   249 ----------------TIGNERFRCPEALFQPSFLGME-SCGIHETTFNSIMKCDVDIRKDLYAN 296

  Fly   319 IVLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSM 383
            .|||||:||:.....|:|::|.                .:.|..:.:::|....::|:||.|||:
Mouse   297 TVLSGGTTMYPGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSI 345

  Fly   384 LASTPEFYQVCHTKAAYEEYGPSICRHNPVF 414
            |||...|.|:..:|..|:|.||||. |...|
Mouse   346 LASLSTFQQMWISKQEYDESGPSIV-HRKCF 375

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 153/422 (36%)
COG5277 6..410 CDD:227602 151/415 (36%)
ActbNP_031419.1 PTZ00281 1..375 CDD:173506 152/420 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.