DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Arp3 and POTEB3

Sequence 1:NP_001261559.1 Gene:Arp3 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_997238.2 Gene:POTEB3 HGNCID:51240 Length:581 Species:Homo sapiens

Alignment Length:162 Identity:32/163 (20%)
Similarity:60/163 (37%) Gaps:54/163 (33%)


  Fly   204 IQSLLREREVGIPPEQ-SLETAK--AIKEKHCYICPDIAKEFAKYDTEPGKWIRNFSGVNTVTKA 265
            |.:||.|:.|.:..:. |.:||:  |:...|..|| ::..::.:      |.:...|..|     
Human   320 IVNLLLEQNVDVSSQDLSGQTAREYAVSSHHHVIC-ELLSDYKE------KQMLKISSEN----- 372

  Fly   266 PFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDN----VIQNCPID--VRRPLYNNIVLSGG 324
                                  |||:..:.|:...::    |.:|...:  .:.|..|       
Human   373 ----------------------SNPEQDLKLTSEEESQRLKVSENSQPEKMSQEPEIN------- 408

  Fly   325 STMFKDFGRRLQRDIKRSVDTRLRISENLSEG 356
                ||..|.::.:||:.....:.:.|||:.|
Human   409 ----KDCDREVEEEIKKHGSNPVGLPENLTNG 436

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 32/163 (20%)
COG5277 6..410 CDD:227602 32/163 (20%)
POTEB3NP_997238.2 Ank_4 143..193 CDD:290365
ANK 167..292 CDD:238125
ANK 1. {ECO:0000255} 172..201
ANK repeat 174..203 CDD:293786
Ank_2 177..269 CDD:289560
ANK repeat 205..236 CDD:293786
ANK 2. {ECO:0000255} 205..234
ANK 233..357 CDD:238125 12/38 (32%)
ANK repeat 238..269 CDD:293786
ANK 3. {ECO:0000255} 238..267
Ank_2 243..335 CDD:289560 5/15 (33%)
ANK repeat 271..302 CDD:293786
ANK 4. {ECO:0000255} 271..300
ANK repeat 304..335 CDD:293786 5/15 (33%)
ANK 5. {ECO:0000255} 304..333 5/13 (38%)
ANK 6. {ECO:0000255} 337..366 8/36 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.