DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nmo and mapk8a

Sequence 1:NP_001356976.1 Gene:nmo FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001103859.1 Gene:mapk8a ZFINID:ZDB-GENE-080218-17 Length:427 Species:Danio rerio

Alignment Length:408 Identity:144/409 (35%)
Similarity:219/409 (54%) Gaps:56/409 (14%)


  Fly    44 RPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQP 108
            ||||.||.|:|.:..|....|.||:|||...||:...:||.:|||.::....|:|::..|::..|
Zfish    30 RPIGSGAQGIVCSAYDNNLERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTP 94

  Fly   109 PH-LDFFQEIYVITELLQSDLHKIIVSPQHLSADH--IKVFLYQILRGLKYLHSARILHRDIKPG 170
            .. |:.||::|::.||:.::|.::|    .:..||  :...|||:|.|:|:||:|.|:|||:||.
Zfish    95 QKTLEEFQDVYLVMELMDANLCQVI----QMELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPS 155

  Fly   171 NLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGE 235
            |::|.|:|.|||.||||||.......  ||..|||:||||||:::| ..|.:.|||||||||..|
Zfish   156 NIVVKSDCTLKILDFGLARTAATGLL--MTPYVVTRYYRAPEVILG-MGYQANVDVWSVGCIMAE 217

  Fly   236 LLGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPPSFS-------VLYT 293
            ::...:||...:.:.|...:.|.|||||.|.:....:..||::..| |:...:|       ||:.
Zfish   218 MVRGSVLFPGSDHIDQWNKVIEQLGTPTQEFLLKLNQSVRTYVENR-PRYTGYSFEKLFPDVLFP 281

  Fly   294 L-SSHA---THEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQY 354
            . |.|:   ..:|..||.:|||.|..|||||.:||.|||::   :.|...               
Zfish   282 ADSEHSKLKASQARDLLSKMLVIDASKRISVDEALQHPYIN---VWYDPA--------------- 328

  Fly   355 TADFEPSAGQPF---DDLWERKLTSVQQVKEEMHKFI---AEQLQTGRVPLCINPQSAAF----- 408
                |..|..|.   ..|.||:.| |::.||.::|.:   .|:::.|.:....:|..||.     
Zfish   329 ----EVEAPSPLITDKQLDEREHT-VEEWKELIYKEVLDWEERMKNGVIRGQPSPLGAAVINGSP 388

  Fly   409 KSFASSTVAHPSELPPSP 426
            :..:||::...|.:...|
Zfish   389 QPSSSSSINDVSSMSTEP 406

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 None
mapk8aNP_001103859.1 STKc_JNK 25..360 CDD:270840 135/361 (37%)
S_TKc 26..321 CDD:214567 123/299 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112937580
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.