DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nmo and Mapk15

Sequence 1:NP_001356976.1 Gene:nmo FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_006521162.1 Gene:Mapk15 MGIID:2652894 Length:585 Species:Mus musculus

Alignment Length:429 Identity:133/430 (31%)
Similarity:206/430 (48%) Gaps:90/430 (21%)


  Fly    44 RPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLC-FFKHENVLSALDILQ 107
            |.:|.||:|:||...|.|.|..||:||:.:.|:..:.::|.|||:.:|. |..|.|::..||:: 
Mouse    18 RRLGKGAYGIVWKAMDRRTGEVVAIKKIFDAFRDQIDAQRTFREIMLLKEFGGHPNIIRLLDVI- 81

  Fly   108 PPHLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNL 172
            |...|  ::||::.|.:.:||:.:|...:.|...|.:...||:||..|::||.|::|||.||.|:
Mouse    82 PAKND--RDIYLVFESMDTDLNAVIQKGRLLKDIHKRCIFYQLLRATKFIHSGRVIHRDQKPANV 144

  Fly   173 LVNSNCVLKICDFGLAR----VEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIF 233
            |::|.|.:|:|||||||    :.|....:.:|:.|.|::|||||:|:.:|.|:..||:||:|||.
Mouse   145 LLDSACRVKLCDFGLARSLGDLPEGPGGQALTEYVATRWYRAPEVLLSSRWYTPGVDMWSLGCIL 209

  Fly   234 GELLGRRILFQAQNPVQQLELITELLGTPTME------------------------------DMR 268
            ||:|..:.||...:...|||||.:.:..|:||                              |.|
Mouse   210 GEMLRGQPLFPGTSTFHQLELILKTIPLPSMEELQDLGSDYSALILQNLGSRIYTRRKAEVTDRR 274

  Fly   269 HACEGARTHMLRRAPKPPSFSVLYTLSSHATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGR 333
            ....||.....:.|.:.|..::...|......||:.||.::|.|.||||:|...||.|||:.   
Mouse   275 FRAGGALERRRQAAARRPQQTLDALLPPDTPPEALDLLKRLLAFAPDKRLSAEQALQHPYVQ--- 336

  Fly   334 LRYHSCMCKCCFTTSAGMRQYTADFEPSAGQPFDDLWERK-----------LTSVQQVKEEMHKF 387
             |:|   |.                        |..|.|:           ..|..:.::.:::.
Mouse   337 -RFH---CP------------------------DREWARESDVRLPVHEGDQLSAPEYRKRLYQI 373

  Fly   388 IAEQLQTGRVPLCINPQSAAFKSFASSTVAHPSELPPSP 426
            |.||....|.|          :......||..:||..||
Mouse   374 ILEQSGNSRSP----------REEGLGVVASRAELRASP 402

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 None
Mapk15XP_006521162.1 STKc_MAPK15-like 6..374 CDD:270841 122/390 (31%)
S_TKc 14..335 CDD:214567 115/320 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.