DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nmo and Erk7

Sequence 1:NP_001356976.1 Gene:nmo FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001188568.1 Gene:Erk7 FlyBaseID:FBgn0052703 Length:916 Species:Drosophila melanogaster

Alignment Length:470 Identity:138/471 (29%)
Similarity:219/471 (46%) Gaps:117/471 (25%)


  Fly    39 DVQPDRPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFK-HENVLSA 102
            ||:  :.:|.||:|:||..||.|....|||||:.:.|:....::|.:||:..|..|: |.|::..
  Fly    26 DVR--KRMGKGAYGIVWKATDRRTKNTVALKKVFDAFRDETDAQRTYREVIFLRAFRCHPNIVRL 88

  Fly   103 LDILQPP-HLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRD 166
            :||.:.. :|||    |::.|.::||||.:|.....|...|.:..:||::..:|::||..::|||
  Fly    89 VDIFKASNNLDF----YLVFEFMESDLHNVIKRGNVLKDVHKRFVMYQLINAIKFIHSGNVIHRD 149

  Fly   167 IKPGNLLVNSNCVLKICDFGLARV-------EEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAV 224
            :||.|:|::|.|.||:.||||||.       ::.:|...:|..|.|::|||||||:.:|:|:..:
  Fly   150 LKPSNILIDSKCRLKVADFGLARTLSSRRIYDDLEQDGMLTDYVATRWYRAPEILVASRNYTKGI 214

  Fly   225 DVWSVGCIFGELLGRRILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPPSF- 288
            |:|.:|||.||::.::.|||..:.|.|:|.|...|...|..|:              |...||| 
  Fly   215 DMWGLGCILGEMIRQKPLFQGTSTVNQIEKIVTSLPNVTKLDI--------------ASIGPSFG 265

  Fly   289 SVL----------YTLS---SHATHEAVHLLCQMLVFDPDKRISVTDALAHPYLD---------- 330
            |||          |:|.   .:...:.:.|:..:||.:|..|::..:|:.|||:.          
  Fly   266 SVLLSRNIQRDRRYSLDEMMKNCCDDGISLVKALLVLNPHNRLTAKEAIRHPYVSRFQYASAEMD 330

  Fly   331 ---------EGRLRYH----------------SCMCKCCFTTSAGMRQYTADFEP---------- 360
                     :..:||.                ||..:   |.|........|..|          
  Fly   331 LHMDVVPPLKDHVRYDVDQYRNSLYELIDRETSCSNR---TVSNSTPSSNRDELPKPVRVTKQAR 392

  Fly   361 --SAGQPFDDLWERK----LTSVQQVKEEM------HKFIAEQLQTGRVPLCINPQSAAFK--SF 411
              ||.||.....|||    ...|.|.::.:      ||..:::         ||...:|..  |.
  Fly   393 TTSAKQPTTSPAERKKEPSSVEVTQSRKNIKLLGSAHKAQSKE---------INHMESAITQVSI 448

  Fly   412 ASSTVAHPSELPPSP 426
            ||   |.|:..||:|
  Fly   449 AS---APPAAAPPAP 460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nmoNP_001356976.1 None
Erk7NP_001188568.1 STKc_MAPK15-like 17..358 CDD:270841 110/352 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113907615
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D741207at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24055
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.