DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: exex and unpg

Sequence 1:NP_648164.1 Gene:exex FlyBaseID:FBgn0041156 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:464 Identity:121/465 (26%)
Similarity:163/465 (35%) Gaps:132/465 (28%)


  Fly    65 SPRSQITPSP-PAASPTHSAATTGSPVSTYTPALSPGGAQDSSQTESGQSSQMPLLVAPMPVG-T 127
            ||.:::...| |......|.....:| :|.||...|.......:.|..|......:||...:| |
  Fly    17 SPTTRLASKPFPKPFSIESLIANQTP-ATATPPSPPEERDQEQEAEQEQELSARAMVASSALGLT 80

  Fly   128 GPPHSHPPPPHPRLYVEGFPPPHHVPHPH-PALGTYPLPRLPLMLPANPPGVPSGAAAPPPVSPQ 191
            ..|..:|       ::.|:...:|....| .|.|.|        ||::|.|.|:.........||
  Fly    81 QFPLYNP-------WLHGYFAQNHERLTHLIAGGCY--------LPSSPAGHPAAQQPQAQAQPQ 130

  Fly   192 PAANHLSHSGATMATTTLLPPAQSQPKKSFCIDALLAKSQHQSGEPQPIIVDDRLAALHYARDQA 256
            |...|    ..|.|....|||....|     :|.........:....|       ..|.|.|...
  Fly   131 PPPPH----PPTHALEKQLPPTLPHP-----LDTRFLPFNPAAAGVAP-------TDLSYRRLAE 179

  Fly   257 ELNHAFVTASNAAAAAQAAASAAGGISEQEALQRIRDSREYDSPSPDGMSRSESPTSSHRSSPPI 321
            .:|..:|.:.:..|..|..| |||.:.|.:|             :| ||::.:.||.....|.|.
  Fly   180 LMNQDYVHSLSVHARLQHMA-AAGRMHEDQA-------------NP-GMAQLQEPTPPQAHSSPA 229

  Fly   322 SPGCEDQQQPHGALHPQHLSMRMSDFHDEFKKPIPPHSPIRP-------QDFPLYAGGHPYQLLA 379
            ..|                                .|||:.|       :||.           .
  Fly   230 KSG--------------------------------SHSPMEPALDVGMDEDFE-----------C 251

  Fly   380 QGGSAFHRPLDPSGKPIPIPMGHNFMPSQLQFEFLARAGMLHHRIPE-----LAAYPHHAILG-- 437
            .|.|.....|..|      |..:|....:      :|.|...:...|     ..|...|...|  
  Fly   252 SGDSCSDISLTMS------PRNYNGEMDK------SRNGAYTNSDSEDCSDDEGAQSRHEGGGMG 304

  Fly   438 -------------KTRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQN 489
                         |:||.||||||:||||||::|...||||..:|.::|:.|.|||.||||||||
  Fly   305 GKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQN 369

  Fly   490 RRMKWKRSK 498
            ||.||||.|
  Fly   370 RRAKWKRVK 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
exexNP_648164.1 Homeobox 442..495 CDD:278475 35/53 (66%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.