DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8281 and CG3919

DIOPT Version :10

Sequence 1:NP_648161.1 Gene:CG8281 / 38880 FlyBaseID:FBgn0035824 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster


Alignment Length:122 Identity:24/122 - (19%)
Similarity:40/122 - (32%) Gaps:29/122 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 YPEEESIARTWTHKLKRLPREQRLLAERFINEILFEAESNNLHRG--SVQINNSFE--------- 290
            |..:.::...|......:....:...||:.|.....|.|..||.|  :..:|:..:         
  Fly    39 YLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYARSIKLHHGANTYYLNSELKFLQKHITPG 103

  Fly   291 ---PYVRYEETPNGHEEQDKS-------------QSPSVHTS--SESKPNVSGASGS 329
               |.......|.|.||.|:.             .|||...|  ::|:.:...||.:
  Fly   104 VPVPLRGRRSRPKGQEEHDEGDPETPVEAILEMVHSPSFLNSEHAQSRHSTDPASAT 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8281NP_648161.1 MADF_DNA_bdg 26..114 CDD:463144
CG3919NP_001261840.1 MADF 20..100 CDD:214738 11/60 (18%)
BESS 226..260 CDD:460758
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.