DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Snmp2 and santa-maria

Sequence 1:NP_001163372.1 Gene:Snmp2 FlyBaseID:FBgn0035815 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster

Alignment Length:549 Identity:138/550 (25%)
Similarity:235/550 (43%) Gaps:110/550 (20%)


  Fly     6 LIVSALGVCVAVLGGYCG--WI-LFPNMVHKKVEQSVVIQDGSEQFKRFVNLPQPLNFKVYIFNV 67
            ||:...|.|:.:.|..||  |: ||..::||:    :.:...:..::.:.:.|..|:..:|::|.
  Fly    17 LIIGIFGFCLGLFGILCGMFWVDLFDWIMHKE----MALAPDTRVYENWKSPPIDLSLDIYLYNW 77

  Fly    68 TN-SDRIQQGAIPIVEEIGPYVYKQFRQKKVKHFSRDGSKISYVQNVHFDFDAVASAPYTQDDRI 131
            || .|.......||:|::|||.:.:...|...|:..:.:.::|.:...|.||| |.:..:.||.|
  Fly    78 TNPEDFGNLSTKPILEQVGPYRFIERPDKVDIHWHPENASVTYRRRSLFYFDA-AGSNGSLDDEI 141

  Fly   132 VALNMHMNAFLQVFEREITDIFQGFANRLNSRLNQTPGVRVLKRLMERIRGKRKSVLQISENDPG 196
            ..||                   ..|....:.....|.|            ||..|      |.|
  Fly   142 TTLN-------------------AVALSAAATAKYWPPV------------KRSLV------DVG 169

  Fly   197 LALLLVHLNANLKAVFNDPRSMFVSTSVREYLFDGVRFCINPQGIAKAIC-NQIKESGSKTIREK 260
            |.:.              ...|.|..|:.|.||.|....:....:|..|. :::|....|     
  Fly   170 LKMY--------------GAEMSVQKSIDELLFTGYNDAMIDVAMAMPIFGDEVKVPFDK----- 215

  Fly   261 SDGSLAFSFFGHKNGSGH--EVYEVHTGKGDPMRVLEIQKLDDSHNLQVWLNASSEG-ETSVCNQ 322
                  |.:|..:|||..  .|:.|.||..      ::.||...|:   |....:.| ..|.|..
  Fly   216 ------FGWFYTRNGSADLTGVFNVFTGAD------QLAKLGQMHS---WNYQENTGFFDSYCGM 265

  Fly   323 INGTDASAYPPFRQRGDSMYIFSADICRSVQLFYQTDIQYQGIPGYRYSIGENFINDIGPEH-DN 386
            .||:.....|...:.|||:.:|:.|:||::.|.|...:..:|:.||::|.|...: |.|.:: :|
  Fly   266 TNGSAGEFQPQHLKPGDSVGLFTPDMCRTIPLDYVETVDIEGLEGYKFSGGPRSV-DNGTQYPEN 329

  Fly   387 ECFCVDKLANVIKRKNGCLYAGALDLTTC-LDAPVILTLPHMLGASNEYRKMIRGLKPDAKKHQT 450
            .|||..:          |:.:|.:::::| ..:||.::.||...|...|...:.||.|:.|.|:.
  Fly   330 LCFCGGQ----------CVPSGVMNISSCRFGSPVFMSYPHFFNADPYYPDQVEGLSPNQKDHEF 384

  Fly   451 FVDVQSLTGTPLQGGKRVQFNMFLKSINRIGITENLPTVLMPAIWVEEGIQLNGEMVAFFKKKLI 515
            ::.||..||.||:...|.|.||.::.|..|.:...:|.:..|.:|.|:.:::..:|.        
  Fly   385 YMVVQPSTGIPLEVAARFQVNMLVEPIQGISLYTGIPRIFFPLVWFEQKVRITPDMA-------- 441

  Fly   516 NTLKTLNIV----H-WATLCGGIGVAVAC 539
            :.||.|.||    | :|.:|..:|:.:.|
  Fly   442 DQLKVLPIVMLSGHIFAGICLIVGITLLC 470

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Snmp2NP_001163372.1 CD36 12..541 CDD:279474 136/544 (25%)
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 136/544 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52879919
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.