DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7457 and SLF1

Sequence 1:NP_001303376.1 Gene:CG7457 FlyBaseID:FBgn0035812 Length:1405 Species:Drosophila melanogaster
Sequence 2:NP_115666.2 Gene:SLF1 HGNCID:25408 Length:1058 Species:Homo sapiens

Alignment Length:944 Identity:195/945 (21%)
Similarity:341/945 (36%) Gaps:305/945 (32%)


  Fly     2 EEKRYLKRKEK--ARSDGNRDQVAVSCNQLGDFYNQQGKYTDAVREYVQEAQIYASMGKELETAK 64
            |.::.:|:|::  .||...|.:            .::||.::. ::.|:..:|.:::.:.:....
Human   292 ENQKEIKKKDEDIQRSYTLRRK------------RKKGKESNC-KKGVEHEKIKSTLRRHIYNRD 343

  Fly    65 AKRMVGEMYTLLCDYDAAKDHINDYLKIAK--RLKNQVEEQRAYATLGRVHLLHGQSL------A 121
            .|.|...::.             :|.|.:|  .:|..|:......|| |.|:...|::      .
Human   344 QKEMKNSIFA-------------EYAKESKAMAIKTDVDVVEIKNTL-RKHIYRAQAVRYNCIRI 394

  Fly   122 DSSASGSMEQLKLAE-----KNFLRSLL---LIKDLSGQISKLEQLDMQARCYLNI---GVVKEH 175
            |.....::| :|.||     .|.:.||:   ..|:...::|.|:...:...|.|:.   .|::::
Human   395 DKQPVYNVE-VKNAEFPRGVLNLIESLIEGHFFKEAIEELSTLQAHYIPPVCVLHALLENVLQDN 458

  Fly   176 MEAFQESIEYIDKAI----------KISKTH-EL----------WDLTHLCYISMSLLYICKKND 219
            ::.|.....:|..|:          .:|:.: ||          |.|..:      |:..|..|:
Human   459 IDTFSGRYFHILSALLHLHPPWKSPAMSRYYLELFQCPTCMKGAWSLVEV------LIRSCLFNE 517

  Fly   220 ATAALRFCNMALEVAKRFPNKVKKICETLITKAEILIKAGDFASAKQILTKAYKKNTPDENDRVN 284
            :     ||:   ::::...:||..:  ||:.....||:    :..:.:..|.|     |.:|..|
Human   518 S-----FCH---QISENIGSKVLHL--TLLKFFFNLIE----SEVQHLSQKLY-----DWSDSQN 563

  Fly   285 IE---KQLRIVVKVCQTLDELVLTSSVDYAKLKGLYE-----KLGDGCCHLMNY------EKALT 335
            ::   |.:.:.:....:....:||..|:......:|.     |..|...|.:.|      ..|:.
Human   564 LKITGKAMLLEIFWSGSETSGLLTKPVNMLLEWTIYSHKEKFKSNDVFKHELAYLLAGILGAAID 628

  Fly   336 YY----QKMLENA--ELNQESGKSLVPIYVSLYQTYRDNGQFDKALEYLWKEFEL----NQDAPS 390
            |:    .||..|.  .::.:.|.     ||||           ...::..:|.|:    ...:..
Human   629 YWIFLGLKMGRNVMRHMSDDLGS-----YVSL-----------SCDDFSSQELEIFICSFSSSWL 677

  Fly   391 EAFTTLCTIAEICEQ-----QSHPFWTVHDVYQ--KALRQADKAGS----CSDKLVKIAMVRLRR 444
            :.|.......::|.|     .|.|......||.  .||.:....||    .|.|:.:......:|
Human   678 QMFVAEAVFKKLCLQSSGSVSSEPLSLQKMVYSYLPALGKTGVLGSGKIQVSKKIGQRPCFDSQR 742

  Fly   445 --LMLKHNMQVLVENLEADATAKGIDLDQ---EESVGDDEEESDGGGTAVQQNTPDWDDDFDLAT 504
              |||....|..||.|     .:.:||:.   ..|:...:::|:|..:..::|.|.         
Human   743 TLLMLNGTKQKQVEGL-----PELLDLNLAKCSSSLKKLKKKSEGELSCSKENCPS--------- 793

  Fly   505 LTDSDASDLDETEKPRPQRTTRGNRTLVIKKNN------KGETQLHQACISGNLE-LVRRLIDQG 562
                                       |:||.|      ||||.||:|||:..:| |:..|...|
Human   794 ---------------------------VVKKMNFHKTNLKGETALHRACINNQVEKLILLLSLPG 831

  Fly   563 HTVNVRDHAGWLPLHEACNHGYREIVELLLDKGAASAINDKGGTSCDGITPLFDACSNGFLDVAE 627
            ..:||:|:|||.|||||||:|....|:.:|.:.....:.    |..||:|||.||.|||.:::.:
Human   832 IDINVKDNAGWTPLHEACNYGNTVCVQEILQRCPEVDLL----TQVDGVTPLHDALSNGHVEIGK 892

  Fly   628 LLLDRGADATVRTDYNETCIAGLDKWRQGAQLVDGEQAQYAQLRERLLRTLSKVGICSDKNARPL 692
            |||..|                      |..|:....|                     |...||
Human   893 LLLQHG----------------------GPVLLQQRNA---------------------KGELPL 914

  Fly   693 TNFNAKRISREERGSMSEEEDEEEALHESNRRSLSHNRSGSEYGAKK------------SKSSTQ 745
            ....:.:| :||..::::.||..|..|....:...:.:  .|:|:..            ..||..
Human   915 DYVVSPQI-KEELFAITKIEDTVENFHAQAEKHFHYQQ--LEFGSFLLSRMLLNFCSIFDLSSEF 976

  Fly   746 PSASKEYRSVMAHLKRPNRLNDDPPSTSTLNKHKRNAFLSEDEVDADNWLIDDVGPERKRKRINS 810
            ..|||.    :.||   |.|      ......||....:..|      ||:|          :.:
Human   977 ILASKG----LTHL---NEL------LMACKSHKETTSVHTD------WLLD----------LYA 1012

  Fly   811 GDLSRRTSKENFQDTALSLPANWEDDLLQATPEN 844
            |::.          |...||     .:|:..|||
Human  1013 GNIK----------TLQKLP-----HILKELPEN 1031

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7457NP_001303376.1 TPR_12 21..95 CDD:290160 9/76 (12%)
TPR 68..387 CDD:223533 70/383 (18%)
TPR repeat 163..191 CDD:276809 6/41 (15%)
TPR repeat 196..233 CDD:276809 9/48 (19%)
TPR repeat 238..273 CDD:276809 8/35 (23%)
TPR repeat 316..342 CDD:276809 9/41 (22%)
TPR repeat 347..384 CDD:276809 7/37 (19%)
TPR repeat 389..422 CDD:276809 9/40 (23%)
ANK 535..647 CDD:238125 46/119 (39%)
ANK repeat 539..569 CDD:293786 14/31 (45%)
Ank_2 543..639 CDD:289560 40/97 (41%)
ANK repeat 571..604 CDD:293786 13/33 (39%)
ANK repeat 609..639 CDD:293786 14/30 (47%)
LRR_RI 1063..1360 CDD:238064
leucine-rich repeat 1088..1115 CDD:275381
leucine-rich repeat 1116..1170 CDD:275381
leucine-rich repeat 1199..1225 CDD:275381
leucine-rich repeat 1226..1261 CDD:275381
leucine-rich repeat 1262..1289 CDD:275381
leucine-rich repeat 1290..1315 CDD:275381
SLF1NP_115666.2 BRCT <12..88 CDD:320726
ANK 803..918 CDD:238125 50/162 (31%)
ANK 1 806..836 14/30 (47%)
ANK repeat 807..838 CDD:293786 14/31 (45%)
ANK repeat 840..871 CDD:293786 13/35 (37%)
ANK 2 840..869 13/29 (45%)
ANK repeat 874..904 CDD:293786 16/52 (31%)
ANK 3 874..903 16/51 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R9641
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.