DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7457 and Tonsl

Sequence 1:NP_001303376.1 Gene:CG7457 FlyBaseID:FBgn0035812 Length:1405 Species:Drosophila melanogaster
Sequence 2:NP_898914.3 Gene:Tonsl MGIID:1919999 Length:1363 Species:Mus musculus

Alignment Length:1439 Identity:402/1440 (28%)
Similarity:630/1440 (44%) Gaps:219/1440 (15%)


  Fly     2 EEKRYL-KRKEKARSDGNRDQVAVSCNQLGDFYNQQGKYTDAVREYVQEAQIYASMGKELETAKA 65
            :|.|.| |.|.:|:.:|...:.|..|:|||:.....|::.||:.|:.||..:..|:...|..|.|
Mouse     5 QELRQLSKAKTRAQRNGQLREEAAYCHQLGELLASHGRFKDALEEHQQELHLLESVQDTLGCAVA 69

  Fly    66 KRMVGEMYTLLCDYDAAKDHINDYLKIAKRLKNQVEEQRAYATLGRVHLLHGQSLADSSASGSME 130
            .|.:||....:.:|.||..|.:.||.:|..|.|..|.|||:||:||.||    .:.|...  |.:
Mouse    70 HRKIGERLAEMENYSAALKHQHLYLDLAGSLSNHTELQRAWATIGRTHL----DIYDHCQ--SRD 128

  Fly   131 QLKLAEKNFLRSLLLIKD-LSGQISKLEQLDMQARCYLNIGVVKEHMEAFQESIEYIDKAIKISK 194
            .|..|:..|.:||.::.: |.|.:::.|..:|:.|.|||:|:..|.::.......|..|:|.:::
Mouse   129 SLLQAQAAFEKSLAIVDEKLEGMLTQRELSEMRTRLYLNLGLTCESLQQTALCNNYFKKSIFLAE 193

  Fly   195 THELWDLTHLCYISMSLLYICKKNDATAALRFCNMALEVAKRFPNKVKKICETLITKAEILIKAG 259
            .:.|::.......::..:: .:....:.|:|....|.|.|:....:..: .|..:..:::|...|
Mouse   194 QNHLYEDLFRARYNLGAIH-WRGGQHSQAMRCLEGARECARAMKMRFME-SECCVLVSQVLQDLG 256

  Fly   260 DFASAKQILTKAYKKNTPDENDRVNIEKQLRIVVKVCQTLDELVLTSSVDYAKLKGLYEKLGDGC 324
            ||.:||:.|.|||:..:...|.||.:.:.|:.|:.|.|...:|......|......:.|:|||..
Mouse   257 DFLAAKRALKKAYRLGSQKPNQRVTVCQSLKYVLAVIQLQQQLEEAEGNDLQGAMAICEQLGDLF 321

  Fly   325 CHLMNYEKALTYYQKMLENAELNQESGKSLVPIYVSLYQTYRDNGQFDKALEYLWKEFELNQDAP 389
            ....::.||...|||.|..|||.......|..|:|||..|..|.....||:.:..:|..|.:...
Mouse   322 SKAGDFPKAAEAYQKQLHLAELLNRPDLELAVIHVSLATTLGDMKDHRKAVHHYEEELRLRKGNA 386

  Fly   390 SEAFTTLCTIAEICEQQSHPFWTVHDVYQKALRQADKAGSCSDKLVKIAMVRLRRLMLKH--NMQ 452
            .|...|...||...|:....:..:...:|||...|.:|          ...:|:|.:|:|  .:|
Mouse   387 LEEAKTWFNIALSREEAGDAYELLAPCFQKAFCCAQQA----------QRFQLQRQILQHLYTVQ 441

  Fly   453 VLVENLEADAT---------AKGIDLDQEESVGDDEEESDGGGTAVQQNTPDWDDDFDLATLTDS 508
            :.::..||..|         ||..:.::||...::||.|:...|:..:.:...||       .|.
Mouse   442 LKLQPQEARDTEIRLQELSMAKDTEEEEEEEEEEEEEASEAPETSELELSESEDD-------ADG 499

  Fly   509 DASDLDETEKPR----PQRTTRGNRTLVIKKNNKGETQLHQACISGNLELVRRLIDQGHTVNVRD 569
            .:..|:|.|:.:    .::..:.||     :|:.|||.||:|||.|.|..|:.|:.|||.:|.||
Mouse   500 LSQQLEEDEELQGCVGRRKVNKWNR-----RNDMGETLLHRACIEGQLRRVQDLVKQGHPLNPRD 559

  Fly   570 HAGWLPLHEACNHGYREIVELLLDKGAASAINDKGGTSCDGITPLFDACSNGFLDVAELLLDRGA 634
            :.||.|||||||:|:.|||..|||.||  |::|.||..|||||||.||.:.|..:|||||::|||
Mouse   560 YCGWTPLHEACNYGHLEIVRFLLDHGA--AVDDPGGQGCDGITPLHDALNCGHFEVAELLIERGA 622

  Fly   635 DATVRTDYNETCIAGLDKWRQGAQL----VDGEQAQYAQLRERLLRTLSKVGICSDKNARPLTNF 695
            ..|:||....:.:..|.:|   .:|    :|.|..|.|...|:.|:..|. |..| :::..|...
Mouse   623 SVTLRTRKGLSPLETLQQW---VKLYFRDLDLETRQKAATMEKRLQMASS-GQAS-RSSPALQTI 682

  Fly   696 NAKRISREERGSMSEEEDEEEALHESNRRSLSHNRSGSEYGAKKSKSSTQPSASKEY-RSVMAHL 759
            .:..:...|....|....|.                 |.|..:..::|  |:.:|.: ...::.:
Mouse   683 PSNHLFDPETSPPSSPCPEP-----------------SSYTPRPPEAS--PAPAKVFLEETVSAV 728

  Fly   760 KRPNRLNDDPPSTSTLNKHKRNAFLSEDEVDADNWLIDDVGPERKRKR--INSGDL-------SR 815
            .||.:....|.|:|:         .||||   ||  .....|.:||.|  ...|::       ||
Mouse   729 SRPRKTRHRPTSSSS---------SSEDE---DN--PSPCRPSQKRLRHTTQQGEVKIPDPPKSR 779

  Fly   816 RTSKENFQDTAL-----------------SLPANWEDDLLQAT---PENEYSQRQKQMRKLTLSR 860
            .|:..:....|.                 |||...|:.....|   ||.||...:.......|:|
Mouse   780 ETATSSACRAAYQAAIRGVGSAQSRRLVPSLPRGSEEVPAPKTALIPEEEYLAGEWLEVDTPLTR 844

  Fly   861 S---SSMSSNHSSSATSSR---KKHQATLLDSGFSRFRSESPLGSESSQDGTTSLISVRTIEPDS 919
            |   |:..|::.......|   |:.:.|.||...:|           :|.|..||    ..||..
Mouse   845 SGRPSTSVSDYERCPARPRTRVKQSRLTSLDGWCAR-----------TQAGDGSL----NAEPAE 894

  Fly   920 TTSTIQVLISPAKSSPIK-----------VQATPVLATTVSFKVKIQDELLLVPIERKKLQDINI 973
            ..|.      |..|.|.|           ||..|     :..:|:|||.|.|:|:.:..::.  :
Mouse   895 NPSV------PRTSGPNKENYAAGQPLLLVQPPP-----IRVRVQIQDNLFLIPVPQSDIRP--V 946

  Fly   974 RWLAEEAGRRYNKLTGLTPLLRLKTADGFAYEETDPVSVALEQN-MLMASILDWKISPLSQRYEE 1037
            .||.|:|.:||.:..||.|.|.|: .||......||:...|:.| .::|.:..|.:.||..||..
Mouse   947 AWLTEQAAQRYFQTCGLLPRLTLR-KDGALLAPQDPIPDVLQSNDEVLAEVTSWDLPPLKDRYRR 1010

  Fly  1038 MCLQMQKTVDNKVKLLLERSQNNNMLELSGLWMRAEKTEPIFKAL-LHQARLTVLDLSCNFIGNE 1101
            .||.:.:....:|...::...::.......|.:...:..|:.:|| ||.| |..|.|:.|.:|:.
Mouse  1011 ACLSLGQGEHQQVLHAMDHQSSSPSFSACSLALCQAQLTPLLRALKLHTA-LRELRLAGNRLGDA 1074

  Fly  1102 GCQQLAKSLPTLLQLKALRLQCNAIGSHGLEALLCG-QGMDKLELLEELNLNQNPLGNASVRILS 1165
            ...:|..:|.|...|..|.|..|.:|..||..|:.| .|...|:.||||:|:.||||:.      
Mouse  1075 CATELLATLGTTPNLVLLDLSSNHLGQEGLRQLVEGSSGQAALQNLEELDLSMNPLGDG------ 1133

  Fly  1166 KYCASPAGQALTCLQLAQCELTELQDFDLGFNK-------------------LTRFDISFNQLTQ 1211
                  .||||..|..|...|:.|:....||:.                   |....:|:|.|..
Mouse  1134 ------CGQALASLLRACPMLSTLRLQACGFSSSFFLSHQAALGGAFQDAVHLKTLSLSYNLLGA 1192

  Fly  1212 QSVRRLTDQLNSCRLEQLNLSYVRWPLDDASGFALSERLVTLFEGGTCERFVGVQLAGCGLNDAH 1276
            .::.|:...|.:|.|::|:||.|   ....|...:.|.::.......|........|.| |.|..
Mouse  1193 PALARVLQTLPACTLKRLDLSSV---AASKSNSGIIEPVIKYLTKEGCALAHLTLSANC-LGDKA 1253

  Fly  1277 MYNISQHLAKAKQLQMLDISDNSNLSGTTLGYILDELPQ----LRDLLAVNC-------TNLLDD 1330
            :..:|:.|.....|..||:|.|..:|..:|..:|..|.:    |..|....|       ::|.|.
Mouse  1254 VRELSRCLPCCPSLTSLDLSANPEVSCASLEELLSALQERSQGLSFLGLSGCSIQGPLNSDLWDK 1318

  Fly  1331 I--RLQKLE 1337
            |  :||:|:
Mouse  1319 IFVQLQELQ 1327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7457NP_001303376.1 TPR_12 21..95 CDD:290160 25/74 (34%)
TPR 68..387 CDD:223533 91/320 (28%)
TPR repeat 163..191 CDD:276809 9/28 (32%)
TPR repeat 196..233 CDD:276809 5/37 (14%)
TPR repeat 238..273 CDD:276809 11/35 (31%)
TPR repeat 316..342 CDD:276809 10/26 (38%)
TPR repeat 347..384 CDD:276809 10/37 (27%)
TPR repeat 389..422 CDD:276809 8/33 (24%)
ANK 535..647 CDD:238125 62/112 (55%)
ANK repeat 539..569 CDD:293786 17/30 (57%)
Ank_2 543..639 CDD:289560 56/96 (58%)
ANK repeat 571..604 CDD:293786 20/33 (61%)
ANK repeat 609..639 CDD:293786 18/30 (60%)
LRR_RI 1063..1360 CDD:238064 84/310 (27%)
leucine-rich repeat 1088..1115 CDD:275381 8/27 (30%)
leucine-rich repeat 1116..1170 CDD:275381 20/55 (36%)
leucine-rich repeat 1199..1225 CDD:275381 7/26 (27%)
leucine-rich repeat 1226..1261 CDD:275381 8/35 (23%)
leucine-rich repeat 1262..1289 CDD:275381 6/27 (22%)
leucine-rich repeat 1290..1315 CDD:275381 9/25 (36%)
TonslNP_898914.3 TPR 1 27..60 12/33 (36%)
TPR repeat 27..55 CDD:276809 11/28 (39%)
TPR repeat 66..96 CDD:276809 11/30 (37%)
TPR 2 67..100 12/33 (36%)
TPR repeat 101..131 CDD:276809 14/36 (39%)
TPR 3 107..147 16/46 (35%)
TPR 4 162..195 9/33 (27%)
TPR_12 163..234 CDD:290160 15/72 (21%)
TPR repeat 163..190 CDD:276809 9/27 (33%)
TPR repeat 195..237 CDD:276809 6/43 (14%)
TPR 5 202..235 5/34 (15%)
TPR 6 242..275 11/33 (33%)
TPR repeat 242..270 CDD:276809 11/28 (39%)
TPR_12 310..383 CDD:290160 24/73 (33%)
TPR 7 311..344 13/33 (39%)
TPR repeat 316..339 CDD:276809 9/23 (39%)
TPR repeat 351..381 CDD:276809 10/30 (33%)
TPR 8 352..385 10/33 (30%)
TPR repeat 390..417 CDD:276809 6/27 (22%)
ANK 523..635 CDD:238125 64/119 (54%)
ANK repeat 528..559 CDD:293786 17/31 (55%)
ANK 1 528..557 16/29 (55%)
Ank_2 533..627 CDD:289560 56/96 (58%)
ANK repeat 561..592 CDD:293786 20/33 (61%)
ANK 2 561..590 19/31 (61%)
ANK repeat 597..627 CDD:293786 18/30 (60%)
ANK 3 597..626 18/29 (62%)
LRR_RI 1055..1345 CDD:238064 81/291 (28%)
LRR 1 1060..1081 7/22 (32%)
leucine-rich repeat 1061..1088 CDD:275380 8/27 (30%)
LRR 2 1088..1108 8/20 (40%)
leucine-rich repeat 1089..1119 CDD:275380 11/30 (37%)
LRR 3 1119..1140 13/33 (39%)
leucine-rich repeat 1120..1147 CDD:275380 15/39 (38%)
LRR 4 1147..1168 4/21 (19%)
leucine-rich repeat 1148..1179 CDD:275380 4/31 (13%)
LRR 5 1179..1199 5/20 (25%)
leucine-rich repeat 1180..1204 CDD:275380 6/24 (25%)
LRR 6 1206..1214 4/8 (50%)
leucine-rich repeat 1207..1238 CDD:275380 8/34 (24%)
LRR 7 1238..1261 5/24 (21%)
leucine-rich repeat 1239..1266 CDD:275380 6/28 (21%)
LRR 8 1266..1287 7/21 (33%)
leucine-rich repeat 1267..1289 CDD:275380 8/22 (36%)
leucine-rich repeat 1290..1317 CDD:275380 5/27 (19%)
LRR 9 1296..1317 4/21 (19%)
LRR 10 1322..1343 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BFTE
Hieranoid 1 1.000
Homologene 1 1.000 H22754
Inparanoid 1 1.050 386 1.000 Inparanoid score I2003
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005202
OrthoInspector 1 1.000 T1084863
orthoMCL 1 0.900 OOG5_134410
Panther 1 1.100 LDO PTHR46358
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R9641
TreeFam 1 0.960
1110.850

Return to query results.
Submit another query.