DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7457 and TONSL

Sequence 1:NP_001303376.1 Gene:CG7457 FlyBaseID:FBgn0035812 Length:1405 Species:Drosophila melanogaster
Sequence 2:NP_038460.4 Gene:TONSL HGNCID:7801 Length:1378 Species:Homo sapiens

Alignment Length:1472 Identity:414/1473 (28%)
Similarity:644/1473 (44%) Gaps:260/1473 (18%)


  Fly     2 EEKRYLKRKEKARSDGNRDQVAVSCNQLGDFYNQQGKYTDAVREYVQEAQIYASMGKELETAKAK 66
            |.::..|.|.||:..|.|.:.|..|:|||:.....|:|.:|:.::.||.|:.......|..|.|.
Human     6 ELRQLSKAKAKAQRAGQRREEAALCHQLGELLAGHGRYAEALEQHWQELQLRERADDPLGCAVAH 70

  Fly    67 RMVGEMYTLLCDYDAAKDHINDYLKIAKRLKNQVEEQRAYATLGRVHLLHGQSLADSSASGSMEQ 131
            |.:||....:.||.||..|.:.||::|..|:|..|.|||:||:||.||    .:.|...  |.:.
Human    71 RKIGERLAEMEDYPAALQHQHQYLELAHSLRNHTELQRAWATIGRTHL----DIYDHCQ--SRDA 129

  Fly   132 LKLAEKNFLRSLLLI-KDLSGQISKLEQLDMQARCYLNIGVVKEHMEAFQESIEYIDKAIKISKT 195
            |..|:..|.:||.:: ::|.|.:::.|..:|:.|.|||:|:..|.::......:|..|:|.:::.
Human   130 LLQAQAAFEKSLAIVDEELEGTLAQGELNEMRTRLYLNLGLTFESLQQTALCNDYFRKSIFLAEQ 194

  Fly   196 HELWDLTHLCYISMSLLYICKKNDATAALRFCNMALEVA----KRFPNKVKKICETLITKAEILI 256
            :.|::.......::..:: .:....:.|:|....|.|.|    |||...     |..:..|::|.
Human   195 NHLYEDLFRARYNLGTIH-WRAGQHSQAMRCLEGARECAHTMRKRFMES-----ECCVVIAQVLQ 253

  Fly   257 KAGDFASAKQILTKAYKKNTPDENDRVNIEKQLRIVVKVCQTLDELVLTSSVDYAKLKGLYEKLG 321
            ..|||.:||:.|.|||:..:.....|..|.:.|:.|:.|.:...:|......|......:.|:||
Human   254 DLGDFLAAKRALKKAYRLGSQKPVQRAAICQNLQHVLAVVRLQQQLEEAEGRDPQGAMVICEQLG 318

  Fly   322 DGCCHLMNYEKALTYYQKMLENAELNQESGKSLVPIYVSLYQTYRDNGQFDKALEYLWKEFELNQ 386
            |......::.:|...|||.|..|||....|.....|:|||..|..|......|:.:..:|..|..
Human   319 DLFSKAGDFPRAAEAYQKQLRFAELLDRPGAERAIIHVSLATTLGDMKDHHGAVRHYEEELRLRS 383

  Fly   387 DAPSEAFTTLCTIAEICEQQSHPFWTVHDVYQKALRQADKAGSCSDKLVKIAMVRLRRLMLK--H 449
            ....|...|...||...|:....:..:...:||||       ||:.:..:   .:|:|.:|:  |
Human   384 GNVLEEAKTWLNIALSREEAGDAYELLAPCFQKAL-------SCAQQAQR---PQLQRQVLQHLH 438

  Fly   450 NMQVLVENLEADATAKGIDLDQEESVGDDEEE----SDGGGTAVQQ-------NTPDWDDDFDLA 503
            .:|:.::..||..|...:   :|.||.:||:|    .:...||..:       ...:.:||    
Human   439 TVQLRLQPQEAPETETRL---RELSVAEDEDEEEEAEEAAATAESEALEAGEVELSEGEDD---- 496

  Fly   504 TLTDSDASDLDETEKPR----PQRTTRGNRTLVIKKNNKGETQLHQACISGNLELVRRLIDQGHT 564
              ||.....|:|.|:.:    .::.::.||     :|:.|||.||:|||.|.|..|:.|:.|||.
Human   497 --TDGLTPQLEEDEELQGHLGRRKGSKWNR-----RNDMGETLLHRACIEGQLRRVQDLVRQGHP 554

  Fly   565 VNVRDHAGWLPLHEACNHGYREIVELLLDKGAASAINDKGGTSCDGITPLFDACSNGFLDVAELL 629
            :|.||:.||.|||||||:|:.|||..|||.||  |::|.||..|:|||||.||.:.|..:|||||
Human   555 LNPRDYCGWTPLHEACNYGHLEIVRFLLDHGA--AVDDPGGQGCEGITPLHDALNCGHFEVAELL 617

  Fly   630 LDRGADATVRTDYNETCIAGLDKW-RQGAQLVDGEQAQYAQLRERLLR----------------- 676
            |:|||..|:||....:.:..|.:| :...:.:|.|..|.|:..|.||:                 
Human   618 LERGASVTLRTRKGLSPLETLQQWVKLYRRDLDLETRQKARAMEMLLQAAASGQDPHSSQAFHTP 682

  Fly   677 --------TLSKVGIC-------------SDKNARPLTNFNAKRISREER--------GSMSEEE 712
                    |...:..|             |..:.|......|..::|..|        .|.||.|
Human   683 SSLLFDPETSPPLSPCPEPPSNSTRLPEASQAHVRVSPGQAAPAMARPRRSRHGPASSSSSSEGE 747

  Fly   713 DEEEALHESNRR---SLSHNR--SGSEYGAKKSKSSTQPSASKEYRSVMAHL-KRPNRLNDDPPS 771
            |.......|.:|   |.:..|  :.:...|...:::|..::...|::.:..: ...:||...||.
Human   748 DSAGPARPSQKRPRCSATAQRVAAWTPGPASNREAATASTSRAAYQAAIRGVGSAQSRLGPGPPR 812

  Fly   772 TSTLNKHKRNAFLSEDEVDADNWLIDDVGPERKR--KRINSGDLSRRTSKENFQDTALSLPANWE 834
            ..:.....:.|.:.|:|..|.:||..|:...|.|  :...:|| :||.|..:..|:..|.|    
Human   813 GHSKALAPQAALIPEEECLAGDWLELDMPLTRSRRPRPRGTGD-NRRPSSTSGSDSEESRP---- 872

  Fly   835 DDLLQATPENEYSQRQKQMRKLTLSRSSSMSSNHSSSATSSRKKHQATLLDSGFSRFRSESPLGS 899
                        ..|.||:| ||..:|.|...|                  :|.|...||.| ||
Human   873 ------------RARAKQVR-LTCMQSCSAPVN------------------AGPSSLASEPP-GS 905

  Fly   900 ESSQDGTTSLISVRTIEPDSTTSTIQVLISPAKSSPIKVQATPVLATTVSFKVKIQDELLLVPIE 964
            .|:.         |..||...:|.....:.||...||:|            :|::||.|.|:|:.
Human   906 PSTP---------RVSEPSGDSSAAGQPLGPAPPPPIRV------------RVQVQDHLFLIPVP 949

  Fly   965 RKKLQDINIRWLAEEAGRRYNKLTGLTPLLRLKTADGFAYEETDPVSVALEQN-MLMASILDWKI 1028
            ... ...::.||||:|.:||.:..||.|.|.|: .:|......|.:...|:.| .::|.:..|.:
Human   950 HSS-DTHSVAWLAEQAAQRYYQTCGLLPRLTLR-KEGALLAPQDLIPDVLQSNDEVLAEVTSWDL 1012

  Fly  1029 SPLSQRYEEMCLQMQKTVDNKVKLLLERSQNNNMLELSGLWM----------RAEKTEPIFKAL- 1082
            .||:.||...|..:.:.         |..|....:||.||.:          :|:.| |:.:|| 
Human  1013 PPLTDRYRRACQSLGQG---------EHQQVLQAVELQGLGLSFSACSLALDQAQLT-PLLRALK 1067

  Fly  1083 LHQARLTVLDLSCNFIGNEGCQQLAKSLPTLLQLKALRLQCNAIGSHGLEALLCG-QGMDKLELL 1146
            ||.| |..|.|:.|.:|::...:|..:|.|:..|..|.|..|.:|..||..|..| .|...|:.|
Human  1068 LHTA-LRELRLAGNRLGDKCVAELVAALGTMPSLALLDLSSNHLGPEGLRQLAMGLPGQATLQSL 1131

  Fly  1147 EELNLNQNPLGNASVRILSKYC-ASPAGQALTCLQLAQCEL-------------TELQDFDLGFN 1197
            |||:|:.||||:...:.|:... |.|   .|:.|:|..|..             :..||.:    
Human  1132 EELDLSMNPLGDGCGQSLASLLHACP---LLSTLRLQACGFGPSFFLSHQTALGSAFQDAE---- 1189

  Fly  1198 KLTRFDISFNQLTQQSVRRLTDQLNSCRLEQLNLSYVRWPLDDASGFALSERLVTLFEGGTCERF 1262
            .|....:|:|.|...::.|....|.:..|..|.||.|      |:|...|:.:..:|      |:
Human  1190 HLKTLSLSYNALGAPALARTLQSLPAGTLLHLELSSV------AAGKGDSDLMEPVF------RY 1242

  Fly  1263 VGVQLAGCGLNDAHMYNISQHLA-KA-----------KQLQMLDISDNSNLSGTTLGYILDEL-- 1313
            :..:  ||.|  ||:...:.||. ||           ..|..||:|.|..:|..:|..:|..|  
Human  1243 LAKE--GCAL--AHLTLSANHLGDKAVRDLCRCLSLCPSLISLDLSANPEISCASLEELLSTLQK 1303

  Fly  1314 -PQLRDLLAVN-CT-------NLLDDIRLQKLEQLKQLPRRL 1346
             ||....|.:: |.       .|.|.|..| |.:|:...|||
Human  1304 RPQGLSFLGLSGCAVQGPLGLGLWDKIAAQ-LRELQLCSRRL 1344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7457NP_001303376.1 TPR_12 21..95 CDD:290160 25/74 (34%)
TPR 68..387 CDD:223533 92/324 (28%)
TPR repeat 163..191 CDD:276809 9/28 (32%)
TPR repeat 196..233 CDD:276809 5/37 (14%)
TPR repeat 238..273 CDD:276809 12/35 (34%)
TPR repeat 316..342 CDD:276809 9/26 (35%)
TPR repeat 347..384 CDD:276809 9/37 (24%)
TPR repeat 389..422 CDD:276809 9/33 (27%)
ANK 535..647 CDD:238125 62/112 (55%)
ANK repeat 539..569 CDD:293786 17/30 (57%)
Ank_2 543..639 CDD:289560 56/96 (58%)
ANK repeat 571..604 CDD:293786 20/33 (61%)
ANK repeat 609..639 CDD:293786 18/30 (60%)
LRR_RI 1063..1360 CDD:238064 96/334 (29%)
leucine-rich repeat 1088..1115 CDD:275381 8/27 (30%)
leucine-rich repeat 1116..1170 CDD:275381 22/56 (39%)
leucine-rich repeat 1199..1225 CDD:275381 6/26 (23%)
leucine-rich repeat 1226..1261 CDD:275381 9/35 (26%)
leucine-rich repeat 1262..1289 CDD:275381 9/39 (23%)
leucine-rich repeat 1290..1315 CDD:275381 10/28 (36%)
TONSLNP_038460.4 TPR_12 23..99 CDD:290160 26/76 (34%)
TPR 1 27..60 11/33 (33%)
TPR repeat 27..55 CDD:276809 10/28 (36%)
TPR repeat 66..96 CDD:276809 12/30 (40%)
TPR 2 67..100 13/33 (39%)
TPR 3 107..147 16/46 (35%)
TPR repeat 107..131 CDD:276809 12/30 (40%)
TPR 4 162..195 9/33 (27%)
TPR repeat 163..190 CDD:276809 9/27 (33%)
TPR 187..>418 CDD:223533 60/237 (25%)
TPR repeat 195..231 CDD:276809 5/37 (14%)
TPR 5 202..235 5/34 (15%)
TPR 6 242..275 12/38 (32%)
TPR repeat 242..270 CDD:276809 12/33 (36%)
TPR repeat 276..300 CDD:276809 6/24 (25%)
TPR 7 311..344 12/33 (36%)
TPR repeat 316..339 CDD:276809 8/23 (35%)
TPR repeat 351..381 CDD:276809 8/30 (27%)
TPR 8 352..385 9/33 (27%)
TPR repeat 390..419 CDD:276809 8/36 (22%)
ANK 523..635 CDD:238125 64/119 (54%)
ANK repeat 528..559 CDD:293786 17/31 (55%)
ANK 1 528..557 16/29 (55%)
Ank_2 533..627 CDD:289560 56/96 (58%)
ANK repeat 561..592 CDD:293786 20/33 (61%)
ANK 2 561..590 19/31 (61%)
ANK repeat 594..627 CDD:293786 19/33 (58%)
ANK 3 597..626 18/29 (62%)
PRR18 707..>919 CDD:292299 58/258 (22%)
LRR_RI 1045..1306 CDD:238064 80/286 (28%)
LRR 1 1069..1093 8/25 (32%)
LRR_8 1072..1141 CDD:290566 26/69 (38%)
leucine-rich repeat 1072..1099 CDD:275380 8/27 (30%)
LRR 2 1097..1122 9/25 (36%)
leucine-rich repeat 1100..1130 CDD:275380 11/30 (37%)
LRR 3 1128..1151 11/23 (48%)
leucine-rich repeat 1131..1158 CDD:275380 12/30 (40%)
leucine-rich repeat 1159..1190 CDD:275380 6/35 (17%)
LRR 4 1188..1212 5/28 (18%)
leucine-rich repeat 1191..1215 CDD:275380 6/24 (25%)
leucine-rich repeat 1216..1249 CDD:275380 12/47 (26%)
LRR 5 1247..1270 9/25 (36%)
leucine-rich repeat 1250..1277 CDD:275380 7/29 (24%)
LRR 6 1275..1300 8/25 (32%)
leucine-rich repeat 1278..1300 CDD:275380 8/22 (36%)
leucine-rich repeat 1308..1333 CDD:275380 5/25 (20%)
LRR 7 1331..1354 6/16 (38%)
leucine-rich repeat 1334..1355 CDD:275380 5/12 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BFTE
Hieranoid 1 1.000
Homologene 1 1.000 H22754
Inparanoid 1 1.050 372 1.000 Inparanoid score I2098
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D37202at33208
OrthoFinder 1 1.000 FOG0005202
OrthoInspector 1 1.000 T1074764
orthoMCL 1 0.900 OOG5_134410
Panther 1 1.100 LDO PTHR46358
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R9641
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.