DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7457 and ags-3

Sequence 1:NP_001303376.1 Gene:CG7457 FlyBaseID:FBgn0035812 Length:1405 Species:Drosophila melanogaster
Sequence 2:NP_741787.1 Gene:ags-3 WormBaseID:WBGene00000092 Length:579 Species:Caenorhabditis elegans

Alignment Length:400 Identity:85/400 (21%)
Similarity:156/400 (39%) Gaps:136/400 (34%)


  Fly    17 GNRDQVAVSCNQLGDFYNQQGKYTDAV--------------------REYVQEAQIYASMGK--E 59
            ||::..|.||..||:.:..:|.|.||:                    |.|...|.||...|:  :
 Worm    78 GNKEGEAKSCANLGNIFKMKGAYNDALTFTFKQLDFAEELGDRVLKSRAYYNIATIYVERGRCTK 142

  Fly    60 LETAKAKR---------------------------------------MVGEMYTLLCDYDAAKDH 85
            ||.|:.|.                                       .:|..|..|.|||.:...
 Worm   143 LEAAEEKNDAKNAEATSDFENAAKYFMLNLEMSEKSEDALTMGRCYGSLGNTYYCLGDYDQSIHF 207

  Fly    86 INDYLKIAKRLKNQVEEQRAYATLGRVHLLHGQSLADSSASGSMEQLKLAEKNFLRSLLLIKDLS 150
            ....|:::::..::...:||:|.:...|.|      .|:...:::..|||           .:|:
 Worm   208 HKLRLELSQQYGDRASMRRAHANIANCHAL------KSNMPLAIQHYKLA-----------YNLA 255

  Fly   151 GQI-SKLEQLDMQARCYLNIGVVKEHMEAFQESIEYIDKAIKISKTHELWDLTH--LCYISMSLL 212
            .:| :|.|:..|.......:.:.||    .|::|.|..:.:||:::.|  |::.  ..|.|::|.
 Worm   256 IEIGNKTEEAQMAYSLANALYIGKE----VQKAITYFQRHLKIARSLE--DISGQLRSYYSLALS 314

  Fly   213 Y--ICKKNDATAALRFCNMALEVAKR-------------FPNKVKKICE-----TLITKAEILI- 256
            :  :|::.   .||.|    |.:|||             ..|.:.:|.|     .|:...|::| 
 Worm   315 FNNLCERR---KALYF----LVLAKRSSLQVNDTSALTDIDNLLNEILEAGQEDVLVDDIELIID 372

  Fly   257 KAGDFASA----KQILTKAYKK--------NTPDE---NDRVNIEKQLRIVVKV------CQTLD 300
            ::.|.|.|    :::....::|        |||::   .||...|:...::.|:      .|.:|
 Worm   373 ESADPAPADIEHRELRLTYFQKRNIHDKPVNTPEDPLAEDRYEKEEFFDMLAKLQSKRMNDQRVD 437

  Fly   301 ELVLTSSVDY 310
            ..||:|::|:
 Worm   438 ASVLSSNLDF 447

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7457NP_001303376.1 TPR_12 21..95 CDD:290160 26/135 (19%)
TPR 68..387 CDD:223533 64/288 (22%)
TPR repeat 163..191 CDD:276809 5/28 (18%)
TPR repeat 196..233 CDD:276809 10/41 (24%)
TPR repeat 238..273 CDD:276809 9/45 (20%)
TPR repeat 316..342 CDD:276809
TPR repeat 347..384 CDD:276809
TPR repeat 389..422 CDD:276809
ANK 535..647 CDD:238125
ANK repeat 539..569 CDD:293786
Ank_2 543..639 CDD:289560
ANK repeat 571..604 CDD:293786
ANK repeat 609..639 CDD:293786
LRR_RI 1063..1360 CDD:238064
leucine-rich repeat 1088..1115 CDD:275381
leucine-rich repeat 1116..1170 CDD:275381
leucine-rich repeat 1199..1225 CDD:275381
leucine-rich repeat 1226..1261 CDD:275381
leucine-rich repeat 1262..1289 CDD:275381
leucine-rich repeat 1290..1315 CDD:275381
ags-3NP_741787.1 TPR_11 7..65 CDD:290150
TPR repeat 9..34 CDD:276809
TPR repeat 39..79 CDD:276809 1/1 (100%)
TPR repeat 149..173 CDD:276809 1/24 (4%)
TPR_12 182..255 CDD:290160 17/90 (19%)
TPR repeat 186..213 CDD:276809 7/27 (26%)
TPR repeat 218..254 CDD:276809 9/53 (17%)
TPR_12 226..297 CDD:290160 21/92 (23%)
TPR repeat 265..293 CDD:276809 6/32 (19%)
GoLoco 417..437 CDD:280368 3/20 (15%)
GoLoco 464..486 CDD:214645
GoLoco 511..533 CDD:214645
GoLoco 549..571 CDD:214645
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.