DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SD and Pglyrp2

DIOPT Version :8

Sequence 1:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_006524773.1 Gene:Pglyrp2 / 57757 MGIID:1928099 Length:544 Species:Mus musculus

Alignment Length:163 Identity:57/164 (35%)
Similarity:88/164 (54%) Gaps:3/164 (2%)


  Fly    25 RAEWNAKPPNGAIDSMETPLPRAVIAHTAGGA--CADDVTCSQHMQNLQNFQMSKQKFSDIGYHY 87
            |..|.|.|..|....:..||....:.||...|  |....:|:..|:::|.|....:|:.||||.:
Mouse   365 RCRWGAAPYRGHPTPLRLPLGFLYVHHTYVPAPPCTTFQSCAADMRSMQRFHQDVRKWDDIGYSF 429

  Fly    88 LIGGNGKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNFEERAPNKEALDAAKELLEQ-AVKQAQLV 151
            ::|.:|.:|:||.....||.....|....|:||:||:....||:.||:..::.|.. |::...|.
Mouse   430 VVGSDGYLYQGRGWHWVGAHTRGYNSRGFGVAFVGNYTGSLPNEAALNTVRDALPSCAIRAGLLR 494

  Fly   152 EGYKLLGHRQVSATKSPGEALYALIQQWPNWSE 184
            ..||||||||:..|..||.||:.|::.||:::|
Mouse   495 PDYKLLGHRQLVLTHCPGNALFNLLRTWPHFTE 527

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 48/140 (34%)
Pglyrp2XP_006524773.1 PGRP 360..505 CDD:128941 48/140 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116404230
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_131026
Panther 1 1.100 O PTHR11022
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.