DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SD and Pglyrp2

DIOPT Version :9

Sequence 1:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_006524773.1 Gene:Pglyrp2 / 57757 MGIID:1928099 Length:544 Species:Mus musculus


Alignment Length:163 Identity:57/163 - (34%)
Similarity:88/163 - (53%) Gaps:3/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RAEWNAKPPNGAIDSMETPLPRAVIAHTAGGA--CADDVTCSQHMQNLQNFQMSKQKFSDIGYHY 87
            |..|.|.|..|....:..||....:.||...|  |....:|:..|:::|.|....:|:.||||.:
Mouse   365 RCRWGAAPYRGHPTPLRLPLGFLYVHHTYVPAPPCTTFQSCAADMRSMQRFHQDVRKWDDIGYSF 429

  Fly    88 LIGGNGKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNFEERAPNKEALDAAKELLEQ-AVKQAQLV 151
            ::|.:|.:|:||.....||.....|....|:||:||:....||:.||:..::.|.. |::...|.
Mouse   430 VVGSDGYLYQGRGWHWVGAHTRGYNSRGFGVAFVGNYTGSLPNEAALNTVRDALPSCAIRAGLLR 494

  Fly   152 EGYKLLGHRQVSATKSPGEALYALIQQWPNWSE 184
            ..||||||||:..|..||.||:.|::.||:::|
Mouse   495 PDYKLLGHRQLVLTHCPGNALFNLLRTWPHFTE 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 47/139 (34%)
Pglyrp2XP_006524773.1 PGRP 360..505 CDD:128941 47/139 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842413
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.710

Return to query results.
Submit another query.