DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SD and PGLYRP4

DIOPT Version :8

Sequence 1:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_065126.2 Gene:PGLYRP4 / 57115 HGNCID:30015 Length:373 Species:Homo sapiens

Alignment Length:168 Identity:60/169 (36%)
Similarity:95/169 (56%) Gaps:16/169 (9%)


  Fly    22 IVTRAEWNAKPPNGAIDSMETPLPR-------AVIAHTAGGACADDVTCSQHMQNLQNFQMSKQK 79
            :|.|:.|.|:         ||..||       .:|.||||..|.....|...::::|:|.:.:.|
Human   213 VVPRSVWGAR---------ETHCPRMTLPAKYGIIIHTAGRTCNISDECRLLVRDIQSFYIDRLK 268

  Fly    80 FSDIGYHYLIGGNGKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNFEERAPNKEALDAAKELLEQA 144
            ..||||::|:|.:|.:|||...:.:|:.....:|.:|||.|:|.|....||..||:||::|::.|
Human   269 SCDIGYNFLVGQDGAIYEGVGWNVQGSSTPGYDDIALGITFMGTFTGIPPNAAALEAAQDLIQCA 333

  Fly   145 VKQAQLVEGYKLLGHRQVSATKSPGEALYALIQQWPNW 182
            :.:..|...|.|:||..|:.|.|||:|||.:|..||::
Human   334 MVKGYLTPNYLLVGHSDVARTLSPGQALYNIISTWPHF 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 49/147 (33%)
PGLYRP4NP_065126.2 PGRP 53..194 CDD:128941
PGRP 211..351 CDD:128941 49/147 (33%)
Interaction with murein 293..302 1/9 (11%)
Interaction with murein 353..354 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116392754
eggNOG 1 0.900 E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1110472at2759
OrthoFinder 1 1.000 FOG0000386
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11022
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.