DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SD and PGRP-LF

DIOPT Version :8

Sequence 1:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_648299.3 Gene:PGRP-LF / 39064 FlyBaseID:FBgn0035977 Length:369 Species:Drosophila melanogaster

Alignment Length:191 Identity:64/192 (33%)
Similarity:105/192 (55%) Gaps:11/192 (6%)


  Fly     6 LLIVGLTA------IAVQGEVP-----IVTRAEWNAKPPNGAIDSMETPLPRAVIAHTAGGACAD 59
            |::|||.|      ::.....|     |:.|:||..:||:|....::.|:...:|.|||...|..
  Fly    32 LMVVGLAAGYFMWMMSFSTHSPNKGLHILDRSEWLGEPPSGKYPHLKLPVSNIIIHHTATEGCEQ 96

  Fly    60 DVTCSQHMQNLQNFQMSKQKFSDIGYHYLIGGNGKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNF 124
            :..|...|:.:|.|.|....:.||||::|:||:|::|.||....:|.........|:.|||||.|
  Fly    97 EDVCIYRMKTIQAFHMKSFGWVDIGYNFLVGGDGQIYVGRGWHIQGQHVNGYGAISVSIAFIGTF 161

  Fly   125 EERAPNKEALDAAKELLEQAVKQAQLVEGYKLLGHRQVSATKSPGEALYALIQQWPNWSEE 185
            ....|....::|||.|:::.|:..:|...|.:..|||:|.|:|||:.|:.|:|.||.::::
  Fly   162 VNMEPPARQIEAAKRLMDEGVRLHRLQPDYHIYAHRQLSPTESPGQKLFELMQNWPRFTQD 222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 49/147 (33%)
PGRP-LFNP_648299.3 PGRP 57..199 CDD:128941 48/142 (34%)
PGRP 236..363 CDD:295442
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5151476
eggNOG 1 0.900 E1_COG5479
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1110472at2759
OrthoFinder 1 1.000 FOG0000386
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11022
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.