DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SD and PGRP-LC

DIOPT Version :8

Sequence 1:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster

Alignment Length:165 Identity:52/166 (31%)
Similarity:82/166 (49%) Gaps:4/166 (2%)


  Fly    23 VTRAEWNAKPPNGAIDSMETPLPRAVIAHTAGGACADDVTCSQHMQNLQNFQMSKQKFSDIGYHY 87
            |.|.:|.|:||...|..:|.|:...:...|....|:....|...::.||.:.:...:..||.|::
  Fly   356 VERQQWLAQPPQKEIPDLELPVGLVIALPTNSENCSTQAICVLRVRLLQTYDIESSQKCDIAYNF 420

  Fly    88 LIGGNGKVYEGRSPSQRGAFAGPNN--DGSLGIAFIGNFEERAPNKEALDAAKELLEQAVKQAQL 150
            ||||:|.||.||..::.||.....|  ..||..|:||:|:...|:.:.|...:.|||:.||..::
  Fly   421 LIGGDGNVYVGRGWNKMGAHMNNINYDSQSLSFAYIGSFKTIQPSAKQLSVTRLLLERGVKLGKI 485

  Fly   151 VEGYKLLGHRQV--SATKSPGEALYALIQQWPNWS 183
            ...|:.....::  |.|....:||||....|.:||
  Fly   486 APSYRFTASSKLMPSVTDFKADALYASFANWTHWS 520

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 43/141 (30%)
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 43/134 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5479
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000386
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11022
RoundUp 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.