DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SD and PGRP-SC2

DIOPT Version :8

Sequence 1:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster

Alignment Length:177 Identity:74/178 (42%)
Similarity:102/178 (57%) Gaps:2/178 (1%)


  Fly     6 LLIVGLTAIAVQGEVPIVTRAEWNAKPPNGAIDSMETPLPRAVIAHTAGGACADDVTCSQHMQNL 70
            ||.|...|.||.| |.|::::||..:..... .|:...|..|||.||||..|:....|...:||:
  Fly     8 LLAVLFCAQAVLG-VTIISKSEWGGRSATSK-TSLANYLSYAVIHHTAGNYCSTKAACITQLQNI 70

  Fly    71 QNFQMSKQKFSDIGYHYLIGGNGKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNFEERAPNKEALD 135
            |.:.|....::||||::||||:|.|||||..:..||.|...|..|:||:|:||:.........:.
  Fly    71 QAYHMDSLGWADIGYNFLIGGDGNVYEGRGWNVMGAHATNWNSKSIGISFLGNYNTNTLTSAQIT 135

  Fly   136 AAKELLEQAVKQAQLVEGYKLLGHRQVSATKSPGEALYALIQQWPNW 182
            |||.||..||.:.|:|.||.|.|||||.:|:.||..::..|:.|.||
  Fly   136 AAKGLLSDAVSRGQIVSGYILYGHRQVGSTECPGTNIWNEIRTWSNW 182

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 59/142 (42%)
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 59/142 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5151563
eggNOG 1 0.900 E1_COG5479
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1110472at2759
OrthoFinder 1 1.000 FOG0000386
orthoMCL 1 0.900 OOG5_131026
Panther 1 1.100 P PTHR11022
RoundUp 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.