DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SD and Pglyrp2

DIOPT Version :8

Sequence 1:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_008774609.1 Gene:Pglyrp2 / 299567 RGDID:1359183 Length:522 Species:Rattus norvegicus

Alignment Length:162 Identity:54/163 (33%)
Similarity:87/163 (53%) Gaps:3/163 (2%)


  Fly    25 RAEWNAKPPNGAIDSMETPLPRAVIAHTAGGA--CADDVTCSQHMQNLQNFQMSKQKFSDIGYHY 87
            |..|.|.|..|....:..||....:.||...|  |....:|:..|:::|.|..:.:.::||||.:
  Rat   357 RCRWGAAPYRGHPTPLRLPLGLLYVHHTYVPAPPCTTFQSCAADMRSMQRFHQNVRGWADIGYSF 421

  Fly    88 LIGGNGKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNFEERAPNKEALDAAKELLEQ-AVKQAQLV 151
            ::|.:|.||:||.....||.....|....|:||.||:....|::.||:..:::|.. |::...|.
  Rat   422 VVGSDGYVYQGRGWHWVGAHTLGYNSRGFGVAFAGNYTGSLPSEAALNTVRDVLPSCAIRAGLLR 486

  Fly   152 EGYKLLGHRQVSATKSPGEALYALIQQWPNWS 183
            ..|||.||||:..|..||.||:.|::.||:::
  Rat   487 PDYKLFGHRQLGKTDCPGNALFNLLRTWPHFT 518

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 46/140 (33%)
Pglyrp2XP_008774609.1 PGRP 352..497 CDD:128941 46/140 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116404566
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11022
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.