DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SD and Pglyrp3

DIOPT Version :8

Sequence 1:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_006501534.1 Gene:Pglyrp3 / 242100 MGIID:2685266 Length:359 Species:Mus musculus

Alignment Length:170 Identity:66/171 (39%)
Similarity:99/171 (58%) Gaps:8/171 (5%)


  Fly    19 EVP------IVTRAEWNAKPPNGAIDSMETPLPRAVIAHTAGGACADDVTCSQHMQNLQNFQMSK 77
            |:|      |..|:.|.|:..:  ...|..|....:|.||||.:|.:...|...:::.|:|.:..
Mouse   190 EIPKKACPNITPRSAWEARETH--CPQMNLPAKFVIIIHTAGKSCNESADCLVRVRDTQSFHIDN 252

  Fly    78 QKFSDIGYHYLIGGNGKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNFEERAPNKEALDAAKELLE 142
            |.|.||.||:|:|.:|:||||...:..|:.....||.:|||||:|||.|:.||:.:|.||:.|::
Mouse   253 QDFCDIAYHFLVGQDGEVYEGVGWNIEGSHTYGYNDIALGIAFMGNFVEKPPNEASLKAAQSLIQ 317

  Fly   143 QAVKQAQLVEGYKLLGHRQVSATKSPGEALYALIQQWPNW 182
            .||.:..|...|.|:||..||...|||:|||.:|:.||::
Mouse   318 CAVAKGYLTSNYLLMGHSDVSNILSPGQALYNIIKTWPHF 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 54/148 (36%)
Pglyrp3XP_006501534.1 PGRP 40..172 CDD:128941
PGRP 197..337 CDD:128941 53/142 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116395288
eggNOG 1 0.900 E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S7191
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000386
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11022
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.840

Return to query results.
Submit another query.