DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SD and PGLYRP2

DIOPT Version :8

Sequence 1:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001350475.1 Gene:PGLYRP2 / 114770 HGNCID:30013 Length:634 Species:Homo sapiens

Alignment Length:162 Identity:56/163 (34%)
Similarity:86/163 (53%) Gaps:3/163 (2%)


  Fly    25 RAEWNAKPPNGAIDSMETPLPRAVIAHTAGGA--CADDVTCSQHMQNLQNFQMSKQKFSDIGYHY 87
            |..|.|.|..|....::.||....:.||...|  |.|...|:.:|:::|.:....|.:.||||.:
Human   385 RCRWGAAPYRGRPKLLQLPLGFLYVHHTYVPAPPCTDFTRCAANMRSMQRYHQDTQGWGDIGYSF 449

  Fly    88 LIGGNGKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNFEERAPNKEALDAAKELLEQ-AVKQAQLV 151
            ::|.:|.|||||.....||....:|....|:|.:||:....|.:.||...::.|.. ||:...|.
Human   450 VVGSDGYVYEGRGWHWVGAHTLGHNSRGFGVAIVGNYTAALPTEAALRTVRDTLPSCAVRAGLLR 514

  Fly   152 EGYKLLGHRQVSATKSPGEALYALIQQWPNWS 183
            ..|.||||||:..|..||:||:.|::.||:::
Human   515 PDYALLGHRQLVRTDCPGDALFDLLRTWPHFT 546

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 48/140 (34%)
PGLYRP2NP_001350475.1 PGRP 380..525 CDD:128941 48/140 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116404441
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_131026
Panther 1 1.100 O PTHR11022
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.