DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34057 and C1galt1

Sequence 1:NP_001033980.2 Gene:CG34057 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_443719.3 Gene:C1galt1 MGIID:2151071 Length:363 Species:Mus musculus

Alignment Length:334 Identity:122/335 (36%)
Similarity:179/335 (53%) Gaps:23/335 (7%)


  Fly    27 FLVLGIMLGIRLTDFIGYLKLWRNNDLRA--------SEKAALLKYPVASEEH------LATWLR 77
            |.:...:|.|.|.:.........:||..|        |.....:.:...|.:|      :|..|.
Mouse    20 FFLCSQLLSILLREEAAIQPNMLHNDPHARHSDDNGHSHLKGQMNFNADSSQHKDENIDVAENLY 84

  Fly    78 REVRILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNILQINKSESRKNLYAKVRT 142
            ::|:|||.|:|.|.:...||..|..||..||||::||||:.:.:...:.:...|.|:.||.|...
Mouse    85 QKVKILCWVMTSPQNLEKKAKHVKATWAQRCNKVLFMSSEENQDFPTVGLKTKEGREQLYWKTIK 149

  Fly   143 GMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYFSQGYMSGGGGYV 207
            ...|||.|||.:.|||:|||||||::::|||..|..|:||..:|||.|||.|..|||||||.|||
Mouse   150 AFQYVHDHYLEDADWFMKADDDTYVIVDNLRWLLSKYNPEQPIYFGRRFKPYVKQGYMSGGAGYV 214

  Fly   208 LSRDALRR-LNLFALNSTTICKLNGESEDVQIGHCLQDVGVIAGDTRDFQGHHRFLPVNP--FTV 269
            ||::|||| :|.|   .|..|..:...||:.:|.|::.:.|.|||:||..|...|.|..|  ..:
Mouse   215 LSKEALRRFVNAF---KTEKCTHSSSIEDLALGRCMEIINVEAGDSRDTIGKETFHPFVPEHHLI 276

  Fly   270 FPTILSNSWLEGYFFHKPNKS-DCCAASAISFHYVKDFEFELFEFFLYYMRVFG-LHRTPRALPS 332
            ...:....|...|.::.|.:. .||:..|:|||||........|:.:|::|.:| |:|...|||.
Mouse   277 KGYLPKTFWYWNYNYYPPIEGPGCCSDIAVSFHYVDGTTMYELEYLVYHLRPYGYLYRYQPALPE 341

  Fly   333 RLGFRQMNE 341
            .: .:::|:
Mouse   342 NI-LKEINQ 349

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 72/151 (48%)
C1galt1NP_443719.3 Galactosyl_T 107..>248 CDD:304462 70/144 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88712953
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.890

Return to query results.
Submit another query.