DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and b3glcta

DIOPT Version :8

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001289180.1 Gene:b3glcta / 799443 ZFINID:ZDB-GENE-110411-147 Length:496 Species:Danio rerio

Alignment Length:220 Identity:56/221 (25%)
Similarity:93/221 (42%) Gaps:30/221 (14%)


  Fly    82 ILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNILQINKSESRKNLYAKVRTGMAY 146
            |...|.|....|:.:..:|.:|||.:.:.|.:.|...|.::..:.:....:.:....|....:..
Zfish   270 IFVAVKTCKKFHSDRVPVVKKTWGKQASLLEYYSDYADPSIPTINLGVPNTERGHCGKTFAILRR 334

  Fly   147 VHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYFSQG---YMSGGGGYVL 208
            ....::...||.|..||||.|.:..|:..|..|:....:..|.|:.....||   |::||||.:.
Zfish   335 FLSSHVPRTDWLLIVDDDTLISLPRLQALLSCYESSEPLCLGERYGYGLGQGGYSYITGGGGMLF 399

  Fly   209 SRDALRRLNLFALNSTTICKLNGESEDVQIGHCLQDVGVIAGDT------------RDFQGH--- 258
            ||:|:.:|    |:|...|..|...:|:.:|.||..:.|....:            |||..|   
Zfish   400 SREAVVQL----LSSGCNCYSNDAPDDMVLGMCLNSLRVPVTHSPLFHQARPEDYARDFLSHQTP 460

  Fly   259 ---HRFLPVNPFTVFPTILSNSWLE 280
               |:...::|..||     |.||:
Zfish   461 ISFHKHWNIDPIAVF-----NKWLK 480

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 41/153 (27%)
b3glctaNP_001289180.1 Galactosyl_T 265..468 CDD:304462 50/202 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.