DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34057 and c1galt1a

Sequence 1:NP_001033980.2 Gene:CG34057 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001070842.1 Gene:c1galt1a ZFINID:ZDB-GENE-061013-303 Length:408 Species:Danio rerio

Alignment Length:297 Identity:120/298 (40%)
Similarity:166/298 (56%) Gaps:21/298 (7%)


  Fly    48 WRNNDLRASEKAAL--LKYP--VASEEHLATWLRREVRILCLVLTMPSSHATKAALVNRTWGARC 108
            ||      .|.:||  ||:|  ...:.|:|..|.::|||||.|:|.||:..:||..|..||...|
Zfish    62 WR------VEGSALINLKHPNQPGEDGHIADELFKKVRILCWVMTGPSNLQSKAQHVKNTWSRHC 120

  Fly   109 NKLIFMSSQTDSNLNILQINKSESRKNLYAKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLR 173
            |.::||||:.|.:...:.:...|.|..||.|......|..|::.:|.||||||||||::|::|||
Zfish   121 NVVLFMSSEEDRSFPTVGLGTGEGRDQLYWKTIRAFHYALKNHGHEADWFLKADDDTFVVVDNLR 185

  Fly   174 LFLYPYDPESSVYFGCRFKAYFSQGYMSGGGGYVLSRDALRR-LNLFALNSTTICKLNGESEDVQ 237
            ..|..|.||..:|||.|||.|..|||||||.|||||::|||| :..|   ||.:|......||:.
Zfish   186 WILSNYTPEQPIYFGKRFKPYTKQGYMSGGAGYVLSKEALRRFVEGF---STKVCTHTTPVEDLA 247

  Fly   238 IGHCLQDVGVIAGDTRDF---QGHHRFLPVNPFTVFPTILSNSWLEGYFFHK-PNKSDCCAASAI 298
            :|.||:.:||:|||:||.   :..|.|:|.:..|  .......|...|.::. .....||:..|:
Zfish   248 MGQCLEKMGVLAGDSRDSLHRETFHPFIPEHHLT--GKFSKTFWYWNYCYYPIVEGPQCCSDLAV 310

  Fly   299 SFHYVKDFEFELFEFFLYYMRVFGL-HRTPRALPSRL 334
            |||||........|::.|::|.||. ||....:|:.|
Zfish   311 SFHYVDPVLMYTLEYYTYHLRPFGYQHRYQPPVPAVL 347

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 70/151 (46%)
c1galt1aNP_001070842.1 Galactosyl_T <169..292 CDD:304462 61/128 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.