DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and B3glct

DIOPT Version :8

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001074673.1 Gene:B3glct / 381694 MGIID:2685903 Length:489 Species:Mus musculus

Alignment Length:248 Identity:63/249 (25%)
Similarity:101/249 (41%) Gaps:47/249 (19%)


  Fly    65 PVASEEHLATWLRREVRILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNILQINK 129
            ||..||           |...|.|....||.:..:|.:||.|:.:.:.:.|...::.:..:.:..
Mouse   254 PVKKEE-----------IFVAVKTCKKFHADRIPIVKKTWAAQASLIEYYSDYAETAIPTVDLGI 307

  Fly   130 SESRKNLYAKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAY 194
            ..:.:....|....:.....|..|:..|.:..||||.|.:..||..|..||....|:.|.|:...
Mouse   308 PNTDRGHCGKTFAILEKFLNHSHNKISWLVIVDDDTLISISRLRHLLSCYDSSDPVFLGERYGYG 372

  Fly   195 FSQG---YMSGGGGYVLSRDALRRLNLFALNSTTICKLNGESEDVQIGHCLQDVGVIAGDT---- 252
            ...|   |::||||.|.||:|:|||    |.|:..|..|...:|:.:|.|...:||....:    
Mouse   373 LGTGGYSYVTGGGGMVFSREAIRRL----LVSSCRCYSNDAPDDMVLGMCFSGLGVPVTHSPLFH 433

  Fly   253 --------RDFQGH------HRFLPVNPFTVFPTILSNSWLEGYFFHKPNKSD 291
                    :|:..|      |:...::|..|:.|     ||      .|::.|
Mouse   434 QARPVDYPKDYLAHQIPVSFHKHWHIDPVKVYLT-----WL------APSEED 475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 44/153 (29%)
B3glctNP_001074673.1 Galactosyl_T 255..457 CDD:304462 55/217 (25%)
Prevents secretion from ER. {ECO:0000255|PROSITE-ProRule:PRU10138} 486..489
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.