DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and B3glct

DIOPT Version :9

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_030110487.1 Gene:B3glct / 381694 MGIID:2685903 Length:582 Species:Mus musculus


Alignment Length:248 Identity:63/248 - (25%)
Similarity:101/248 - (40%) Gaps:47/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PVASEEHLATWLRREVRILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNILQINK 129
            ||..||           |...|.|....||.:..:|.:||.|:.:.:.:.|...::.:..:.:..
Mouse   347 PVKKEE-----------IFVAVKTCKKFHADRIPIVKKTWAAQASLIEYYSDYAETAIPTVDLGI 400

  Fly   130 SESRKNLYAKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAY 194
            ..:.:....|....:.....|..|:..|.:..||||.|.:..||..|..||....|:.|.|:...
Mouse   401 PNTDRGHCGKTFAILEKFLNHSHNKISWLVIVDDDTLISISRLRHLLSCYDSSDPVFLGERYGYG 465

  Fly   195 FSQG---YMSGGGGYVLSRDALRRLNLFALNSTTICKLNGESEDVQIGHCLQDVGVIAGDT---- 252
            ...|   |::||||.|.||:|:|||    |.|:..|..|...:|:.:|.|...:||....:    
Mouse   466 LGTGGYSYVTGGGGMVFSREAIRRL----LVSSCRCYSNDAPDDMVLGMCFSGLGVPVTHSPLFH 526

  Fly   253 --------RDFQGH------HRFLPVNPFTVFPTILSNSWLEGYFFHKPNKSD 291
                    :|:..|      |:...::|..|:.|     ||      .|::.|
Mouse   527 QARPVDYPKDYLAHQIPVSFHKHWHIDPVKVYLT-----WL------APSEED 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 44/152 (29%)
B3glctXP_030110487.1 Galactosyl_T 348..550 CDD:389837 55/216 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.