DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34057 and CG34056

Sequence 1:NP_001033980.2 Gene:CG34057 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001033979.1 Gene:CG34056 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster

Alignment Length:339 Identity:168/340 (49%)
Similarity:236/340 (69%) Gaps:8/340 (2%)


  Fly    21 MIRNIIFLVLGIMLGIRLTDFIGYLKL----WRNNDLRASEKAALLKYPVASEEHLATWLRREVR 81
            |.|||:.||||:::||:||||:.|.:|    :.:..:...|:.|   ..:|:||.||.||..|.|
  Fly     1 MYRNILCLVLGLIIGIQLTDFLEYFQLTDSQFASTSITQLEEGA---SQLATEEELALWLHNETR 62

  Fly    82 ILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNILQINKSESRKNLYAKVRTGMAY 146
            :||:|||:|.:|.::...|..|||.|||||||:|||.|..|.::.:...|.|.|||.|:|..:.|
  Fly    63 VLCMVLTLPKNHQSRVRRVKGTWGRRCNKLIFISSQEDRELGVIDVGVPEDRNNLYLKMRKALEY 127

  Fly   147 VHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYFSQGYMSGGGGYVLSRD 211
            |::::..:|||||||||||:::|||||..|||||||:::|||.||:..|.|||||||.|||:|||
  Fly   128 VYRNHGEDYDWFLKADDDTFVIMENLRFLLYPYDPEAALYFGHRFRTTFPQGYMSGGAGYVMSRD 192

  Fly   212 ALRRLNLFALNSTTICKLNGESEDVQIGHCLQDVGVIAGDTRDFQGHHRFLPVNPFTVFPTILSN 276
            |||||||||.|::..|.:|..|||.|||.|||:|||:|||:||.:|..||||::...:.||..::
  Fly   193 ALRRLNLFAFNNSQFCPINNNSEDRQIGFCLQNVGVVAGDSRDEEGRDRFLPLSLKFMLPTFPTD 257

  Fly   277 SWLEGYFFHKPNKSDCCAASAISFHYVKDFEFELFEFFLYYMRVFGLHRTPRALPSRLGFRQMNE 341
            :||....|::| .::..:.|.|||||||..|||::|:.||.:.:||...:.|.||.|||..::..
  Fly   258 NWLPKLTFYEP-VNETGSTSGISFHYVKIHEFEMYEYLLYRLHIFGTPLSQRTLPPRLGPDELQN 321

  Fly   342 RLQHWSQQVTDNKN 355
            :|..|:|:.:.|.|
  Fly   322 QLNQWAQENSTNSN 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 88/150 (59%)
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 93/159 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88699627
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.