DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and C1GalTA

DIOPT Version :8

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_609258.1 Gene:C1GalTA / 34215 FlyBaseID:FBgn0032078 Length:388 Species:Drosophila melanogaster

Alignment Length:357 Identity:148/358 (41%)
Similarity:212/358 (59%) Gaps:29/358 (8%)


  Fly    23 RNIIFLVLGIMLGIRLTDFIGYLKLWRN-------------NDLRASEKAALLKYP---VASEEH 71
            |:.:.|::|:::|..|.:...|....|:             ||...|.....:..|   |...||
  Fly    20 RSFVSLIVGLIVGFCLAELFVYSTPERSEFMPYDGHRHGDVNDAHHSHDMMEMSGPEQDVGGHEH 84

  Fly    72 ------LATWLRREVRILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNILQINKS 130
                  :|..|..|||:||.::|.||:|..||..|.||||.||||||||||..|..|:.:.:...
  Fly    85 VHENSTIAERLYSEVRVLCWIMTNPSNHQKKARHVKRTWGKRCNKLIFMSSAKDDELDAVALPVG 149

  Fly   131 ESRKNLYAKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYF 195
            |.|.||:.|.:....|:::|::|:.|||||||||||.::||:|..||||.||:.|||||:||.|.
  Fly   150 EGRNNLWGKTKEAYKYIYEHHINDADWFLKADDDTYTIVENMRYMLYPYSPETPVYFGCKFKPYV 214

  Fly   196 SQGYMSGGGGYVLSRDALRRLNLFALNSTTICKL-NGESEDVQIGHCLQDVGVIAGDTRDFQGHH 259
            .|||||||.||||||:|:||..:.||.:..:||. |..:|||:||.|||:|.|:|||:||..|..
  Fly   215 KQGYMSGGAGYVLSREAVRRFVVEALPNPKLCKSDNSGAEDVEIGKCLQNVNVLAGDSRDSNGRG 279

  Fly   260 RFLPVNP-FTVFPTILSNS-WLEGYFFHKPNKS-DCCAASAISFHYVKDFEFELFEFFLYYMRVF 321
            ||.|..| ..:.|:..... |...|.|:|.::. |||:.:|||||||...:..:.::.:|::|.:
  Fly   280 RFFPFVPEHHLIPSHTDKKFWYWQYIFYKTDEGLDCCSDNAISFHYVSPNQMYVLDYLIYHLRPY 344

  Fly   322 GLHRTPRALPSRLGFRQMNERLQHWSQQVTDN 353
            |:..||.|||::|.   :.|.:....:|.|::
  Fly   345 GIINTPDALPNKLA---VGELMPEIKEQATES 373

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 84/151 (56%)
C1GalTANP_609258.1 Galactosyl_T 119..>265 CDD:304462 82/146 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88692508
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.