DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34057 and CG18558

Sequence 1:NP_001033980.2 Gene:CG34057 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_608720.2 Gene:CG18558 FlyBaseID:FBgn0031469 Length:588 Species:Drosophila melanogaster

Alignment Length:282 Identity:112/283 (40%)
Similarity:156/283 (55%) Gaps:15/283 (5%)


  Fly    70 EHLATWLRREVRILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSS---QTDSNLNILQINKSE 131
            :.||..:.|.|||:|||||.|..:.:.|..::.|||..||::|:..|   .|.|.|.|:.:|.|:
  Fly   310 DQLAKMMYRSVRIICLVLTWPKKYMSGARAISETWGRHCNRVIYYGSFPGTTISGLEIVGLNASD 374

  Fly   132 SRKNLYAKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYFS 196
            :|..|:.|.:....:.:::|.:|.|||.|||||||.||||:|..|.||.|.:.:|||..|| ..|
  Fly   375 TRSKLWGKTKAAFRHAYRNYGHEVDWFYKADDDTYAVMENMRKLLKPYSPSNPIYFGSPFK-LGS 438

  Fly   197 QGYMSGGGGYVLSRDALRRLNLFALNSTTICKLNGE-SEDVQIGHCLQDVGVIAGDTRDFQGHHR 260
            ..|||||.|||||:.|:..|||.|..:   |:...: :||..:|.||..:.|.|||:||..|..|
  Fly   439 TLYMSGGAGYVLSKSAVELLNLGAAEN---CQPGDQGTEDYVMGKCLSLLQVQAGDSRDLLGRQR 500

  Fly   261 F--LPVNPFTVFPTILSNSWLEGYFFHKPNKS-DCCAASAISFHYVKDFEFELFEFFLYYMRVFG 322
            |  |.:..|.:........||:.|.:...... :||:..:||.|.|..:|....|..||..|.:|
  Fly   501 FFSLSLEHFLIPNRDDEGFWLQEYLYQTTGTGLECCSTYSISIHNVSPYEMHFLETILYKRRPYG 565

  Fly   323 L---HRTPRAL-PSRLGFRQMN 340
            |   |..||.| .:||..:|.|
  Fly   566 LLAGHAPPRRLSKNRLRKQQYN 587

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 65/154 (42%)
CG18558NP_608720.2 Galactosyl_T <400..>458 CDD:304462 35/59 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131289109
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.