DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34057 and CG3119

Sequence 1:NP_001033980.2 Gene:CG34057 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster

Alignment Length:382 Identity:119/383 (31%)
Similarity:173/383 (45%) Gaps:95/383 (25%)


  Fly    22 IRNIIFLVLGIMLGIRLT--------DFIGYLKLWRNNDLRASEKAALLKYPVASEEHLATWLRR 78
            :|:.:.|:.|.|.|..|.        |.......|.:.....:                ||..|.
  Fly     7 LRSQLHLLTGFMAGFVLAFVLLLYVYDVSRVTPCWSSTSTMTT----------------ATTARI 55

  Fly    79 E----VRILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNILQINK--SESRKNLY 137
            |    .||||:|||.|.:..:.|..|..|||.||::|||.||:....|.::.:.:  ....::|:
  Fly    56 EDGPPPRILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGGGYEDLW 120

  Fly   138 AKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYFSQGYMSG 202
            .|.|.|..:|.:||..:||||||||||||:|||||:..|..:||.:.|:||.:...| :..||||
  Fly   121 NKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRY-NVSYMSG 184

  Fly   203 GGGYVLSRDALRRLNLFALNSTTIC---KLNGESEDVQIGHCLQDVGV--------IAGDTRDFQ 256
            |..|:|||:||.|....|..|..||   |..| .||..:|.|:|:|||        :.|||:.  
  Fly   185 GASYILSREALHRFATQAYESEVICPQPKKMG-IEDFYMGICMQNVGVHFVDSTHALDGDTKP-- 246

  Fly   257 GHHRFLPVNPFTVFPTILSNSWLEGYFFHKPNKSD----------------------CCAASAIS 299
               :|:|::             ||.|.      ||                      ||:..:::
  Fly   247 ---KFMPLD-------------LENYM------SDANYTIPEWLRLMSLSRVETGLACCSNYSVA 289

  Fly   300 FHYVKDFEFELFEFFLYYMRVFGLHR-TPRALPSRLGFRQMNERLQHWSQQVTDNKN 355
            |||.......|:||.:|:::||..:: :.|...|||....:..|.     .:.||.|
  Fly   290 FHYASRERMFLYEFLIYHLKVFDPNQISERGHRSRLTLSDLTRRF-----PLEDNSN 341

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 66/155 (43%)
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 66/151 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88699671
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.