DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34057 and tgy

Sequence 1:NP_001033980.2 Gene:CG34057 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001285425.1 Gene:tgy FlyBaseID:FBgn0030984 Length:373 Species:Drosophila melanogaster

Alignment Length:327 Identity:128/328 (39%)
Similarity:186/328 (57%) Gaps:28/328 (9%)


  Fly    28 LVLGIMLGIRLTDFIGYLKLWRNNDLRA-----SEKAALLKY--PVASEEHLATWLRREVRILCL 85
            |||.|:|  ..|..||....|....|.|     |...:.:.|  |....|.||..:.||||:||.
  Fly    40 LVLLILL--VSTTVIGLFAYWDVMVLNAGALPLSRGTSSVDYMEPGLRNETLAEKMHREVRVLCW 102

  Fly    86 VLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNILQINKSESRKNLYAKVRTGMAYVHKH 150
            |||.|..|.|:|..|.||||.||||:.||:|:.|..|..:.:.|.:..:.|:.|.:....::|:.
  Fly   103 VLTTPKYHKTRAIHVLRTWGKRCNKIYFMTSEPDDELPTVVLTKPDRYEMLWGKTKEAFVHIHEQ 167

  Fly   151 YLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKA----YFSQGYMSGGGGYVLSRD 211
            ..:|.|||:|||||||:.:||||..||||.||:.:|||..:|.    ..::.|||||.||||||:
  Fly   168 MRHEADWFIKADDDTYLFLENLRYMLYPYSPETPIYFGFNYKMVGTHQKNESYMSGGSGYVLSRE 232

  Fly   212 ALRRLNLFA--LNSTTICKLNGE-SEDVQIGHCLQDVGVIAGDTRDFQGHHRFLPVNPFTVFPTI 273
            |||   :||  :|.||.|:...: :|||::|.||.::||.|||:||.|..:||.|:.|   :..:
  Fly   233 ALR---IFAEGVNDTTKCRQEDDHAEDVEMGKCLFNLGVKAGDSRDEQLRNRFYPIAP---YGAL 291

  Fly   274 LSNS-----WLEGYFFHKPNK-SDCCAASAISFHYVKDFEFELFEFFLYYMRVFGLHRTPRALPS 332
            ||.:     ||..|.::.|.. .||.:...::||||...:..::::|.|..::.|..:....||.
  Fly   292 LSGNVGMDFWLYKYAYYNPRSCMDCLSEYPVAFHYVHSKQLYVYDYFNYQFQLSGRAQVAERLPK 356

  Fly   333 RL 334
            ::
  Fly   357 KI 358

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 72/157 (46%)
tgyNP_001285425.1 Galactosyl_T 103..>270 CDD:304462 78/170 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131289060
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.