DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and c1galt1c1

DIOPT Version :9

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_955961.2 Gene:c1galt1c1 / 324052 ZFINID:ZDB-GENE-030131-2772 Length:317 Species:Danio rerio


Alignment Length:295 Identity:73/295 - (24%)
Similarity:133/295 - (45%) Gaps:34/295 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 NNDLRASEKAALLKYPVASEEHLATWLRREVRILCLVLTMPSSHATKAALVNRTWGARCNKLIFM 114
            ::.|:...|..|.|   .||..::.: ..:||:.||::..|.. ....|..|.||...|:|.:|.
Zfish    41 HHHLKPVSKDELQK---LSESQMSEF-AMQVRVYCLIMVTPKL-LVHWATANDTWSKHCDKSVFY 100

  Fly   115 SSQTDSNLNILQINKSESRKNLYAKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPY 179
            :|:....|:.:.:.:.:.    :.::|..:.:.::: ..:..||..|...|:.::|||:..:...
Zfish   101 TSEASKALDAVDLQEQDE----WTRLRKAIQHAYEN-AGDLHWFFIARPTTFAIIENLKYLVLDK 160

  Fly   180 DPESSVYFGCRFKAYFSQGYMSGGGGYVLSRDALRRLNLFALNSTTICKLNGE-----SEDVQIG 239
            ||....|.|...|: ....|:....|.|||.:|:||| :........|...|.     ||:.|:.
Zfish   161 DPSQPFYIGHTEKS-GELDYVEYDSGIVLSYEAMRRL-MEVFKDEDKCPERGRALWKMSEEKQLA 223

  Fly   240 HCLQDVGVIAGDTRDFQGHHRFLPVNPFTVFPTILSNSWLEGYFFHKPNKSD----CCAASAISF 300
            .||:..||.|.:..|.||...|   |..:| .:::|:|..:       |..|    ||:..||:|
Zfish   224 TCLKYSGVFAENGEDAQGKGLF---NKKSV-SSLISDSISQ-------NPGDVVEACCSDMAITF 277

  Fly   301 HYVKDFEFELFEFFLYYMRVFG--LHRTPRALPSR 333
            ..:...:.::..:.:|.:|.:|  .|.:...||.:
Zfish   278 AGMSPSQIQVLMYGVYRLRPYGHDFHDSLTFLPPK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 37/154 (24%)
c1galt1c1NP_955961.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589111
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.