DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and C1GALT1C1

DIOPT Version :9

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001011551.1 Gene:C1GALT1C1 / 29071 HGNCID:24338 Length:318 Species:Homo sapiens


Alignment Length:312 Identity:89/312 - (28%)
Similarity:146/312 - (46%) Gaps:42/312 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GIMLG---IRLTDFIGYLKLWRNN--------DLRASEKAALLKYPVASEEHLATWLRREVRILC 84
            |:|||   ..|...:|::::...|        .|:|..|..:||  ::.:|.:.  |.:..|:.|
Human    11 GVMLGSIFCALITMLGHIRIGHGNRMHHHEHHHLQAPNKEDILK--ISEDERME--LSKSFRVYC 71

  Fly    85 LVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNILQ-INKSESRKNLYAKVRTGMAYVH 148
            ::|..|...:..|| |..||...|:|..|.||:   |:.:.: ||...:  :::..:|....|..
Human    72 IILVKPKDVSLWAA-VKETWTKHCDKAEFFSSE---NVKVFESINMDTN--DMWLMMRKAYKYAF 130

  Fly   149 KHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYFSQGYMSGGGGYVLSRDAL 213
            ..|.::|:||..|...|:.::|||:.||...||....|.|...|:...: |:...||.|||.:::
Human   131 DKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTIKSGDLE-YVGMEGGIVLSVESM 194

  Fly   214 RRLNLFALNSTTICKLNGE-----SEDVQIGHCLQDVGVIAGDTRDFQGHHRFLPVNPFTVFPT- 272
            :|||.. ||....|...|.     |||.|:..||:..||.|.:..|..|.         .||.| 
Human   195 KRLNSL-LNIPEKCPEQGGMIWKISEDKQLAVCLKYAGVFAENAEDADGK---------DVFNTK 249

  Fly   273 ILSNSWLEGYFFHKPNK--SDCCAASAISFHYVKDFEFELFEFFLYYMRVFG 322
            .:..|..|...:| ||:  ..||:..|::|:.:...:..:..:.:|.:|.||
Human   250 SVGLSIKEAMTYH-PNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFG 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 49/155 (32%)
C1GALT1C1NP_001011551.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153891
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.