DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and F37A4.3

DIOPT Version :9

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_498472.2 Gene:F37A4.3 / 185403 WormBaseID:WBGene00018133 Length:272 Species:Caenorhabditis elegans


Alignment Length:246 Identity:50/246 - (20%)
Similarity:78/246 - (31%) Gaps:94/246 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IFLVLGIMLGIRLTDF-IGYLKLWRNNDLRASEKAALLKYPVASEEHLATWLRREVRILCLVLTM 89
            ||| ||::|      | :|  ||.||:.|..|.:....|:             :......|.||:
 Worm     7 IFL-LGLLL------FRVG--KLMRNDKLAWSAEYEAKKF-------------KFYHNTSLFLTL 49

  Fly    90 PSSHATKAALVNRTWGARCNKL--IFMSSQTDSNLNILQINKSESRKNLYAKVRTGMAYVHKHYL 152
            .|:......|..::|   |:|:  .|:                                |..||:
 Worm    50 QSTGPEMTNLCKKSW---CDKVDDYFV--------------------------------VPHHYV 79

  Fly   153 N-------------------------EYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCR-F 191
            |                         :..|::.|.|:.|..:|.|...|..:|....:|...| |
 Worm    80 NWQKPTEQWLIHHFSKMILHTRRLPQQAQWYMFAFDNNYFFVERLIKELSKFDSHLPIYTILRDF 144

  Fly   192 KAYFSQGYMSGGGGYVLSRDALRRLNLFALNSTTICKLNGESEDVQIGHCL 242
            .|......:     .:.||.|   ||.|.......|..|.|:.:..:..|:
 Worm   145 HADIQHKPV-----LIFSRSA---LNTFYDLEEENCSENAENVEEWLTTCM 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 31/178 (17%)
F37A4.3NP_498472.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.