DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and E03H4.3

DIOPT Version :9

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_493146.2 Gene:E03H4.3 / 184018 WormBaseID:WBGene00008471 Length:322 Species:Caenorhabditis elegans


Alignment Length:211 Identity:72/211 - (34%)
Similarity:104/211 - (49%) Gaps:23/211 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 EHLATWLR--REVRILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNI----LQIN 128
            ||.|:.||  ...:|.|.|.|....:..:...:..||..||:...|.|.....:.|:    :..|
 Worm    66 EHSASTLRLPNSGQIFCFVETSERYYNDRVPSIAATWLRRCDNGRFFSKTPLPSANMTYSTVYKN 130

  Fly   129 KSESRKNLYAKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKA 193
            ..:|..:|:.|...|..|.:.|..|.:||:||||||||..|::||.:|...||...:|.|...|:
 Worm   131 LEDSFFDLFRKSIFGFYYSYMHISNSFDWYLKADDDTYFAMDHLREYLNTLDPSKPLYLGYVIKS 195

  Fly   194 YFSQGYMSGGGGYVLSRDALRRLNLFALNSTTICKLNGE--------SEDVQIGHCLQDVGVIAG 250
            ....||.|||.||:||..|::   :|      :.||..:        :||..:|.||..||:...
 Worm   196 GLKNGYNSGGAGYILSNAAVK---IF------VEKLYHDEYGCPYDWAEDRGMGRCLARVGIYPT 251

  Fly   251 DTRDFQGHHRFLPVNP 266
            ||||.:|.:||:|..|
 Worm   252 DTRDDKGFNRFMPYRP 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 51/161 (32%)
E03H4.3NP_493146.2 Galactosyl_T <130..252 CDD:304462 47/130 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163274
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.