DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34057 and E03H4.3

Sequence 1:NP_001033980.2 Gene:CG34057 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_493146.2 Gene:E03H4.3 WormBaseID:WBGene00008471 Length:322 Species:Caenorhabditis elegans

Alignment Length:211 Identity:72/212 (34%)
Similarity:104/212 (49%) Gaps:23/212 (11%)


  Fly    70 EHLATWLR--REVRILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNI----LQIN 128
            ||.|:.||  ...:|.|.|.|....:..:...:..||..||:...|.|.....:.|:    :..|
 Worm    66 EHSASTLRLPNSGQIFCFVETSERYYNDRVPSIAATWLRRCDNGRFFSKTPLPSANMTYSTVYKN 130

  Fly   129 KSESRKNLYAKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKA 193
            ..:|..:|:.|...|..|.:.|..|.:||:||||||||..|::||.:|...||...:|.|...|:
 Worm   131 LEDSFFDLFRKSIFGFYYSYMHISNSFDWYLKADDDTYFAMDHLREYLNTLDPSKPLYLGYVIKS 195

  Fly   194 YFSQGYMSGGGGYVLSRDALRRLNLFALNSTTICKLNGE--------SEDVQIGHCLQDVGVIAG 250
            ....||.|||.||:||..|::   :|      :.||..:        :||..:|.||..||:...
 Worm   196 GLKNGYNSGGAGYILSNAAVK---IF------VEKLYHDEYGCPYDWAEDRGMGRCLARVGIYPT 251

  Fly   251 DTRDFQGHHRFLPVNP 266
            ||||.:|.:||:|..|
 Worm   252 DTRDDKGFNRFMPYRP 267

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 52/162 (32%)
E03H4.3NP_493146.2 Galactosyl_T <130..252 CDD:304462 47/131 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88734875
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.