DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and C17A2.3

DIOPT Version :8

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_494669.1 Gene:C17A2.3 / 182699 WormBaseID:WBGene00015871 Length:348 Species:Caenorhabditis elegans

Alignment Length:256 Identity:71/257 (28%)
Similarity:118/257 (46%) Gaps:28/257 (11%)


  Fly    81 RILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSS----QTDSNLNILQINKSESRKNLYAKVR 141
            :|.|.|.|....:..:...|..||..||:...|.:.    ..|...:.:..|..::..:|:.|..
 Worm   101 QIFCFVETSTKYYKDRVPSVASTWLPRCDHGRFFTKTHLPYPDIAYSTVYRNLRDTYDDLFRKSI 165

  Fly   142 TGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYFSQGYMSGGGGY 206
            ..:.|.:......:||:||.||||::.|::||.:|...:|...:|.|.|...:.:.||.|||.||
 Worm   166 FSLYYSYTSISKHFDWYLKTDDDTFVAMDHLREYLNTLNPAEPLYLGYRLAPFMNNGYNSGGSGY 230

  Fly   207 VLSRDALRRLNLFALNSTTICKLNGESEDVQIGHCLQDVGVIAGDTRDFQGHHRFLPVNPFTVFP 271
            :||..|:|.......::..:|..: ..||..:|.||:.||:...||||.|..:||:|..|..:  
 Worm   231 ILSNAAMRMFVEQLYHNVRLCPYD-RGEDRGMGRCLESVGITPSDTRDDQELNRFMPFRPAEI-- 292

  Fly   272 TILSNSWLEGYFFHKPNKSDCCAASAISFH--------------YVKDFE--FELFEFFLY 316
            .|:.:.|   ::|  |.|....:...::.|              |.::.|  |.:.:||.|
 Worm   293 PIIGSKW---HYF--PLKYPFISKKFVTLHRVPPEMMISLDKSLYSENGEPTFNVTDFFNY 348

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 44/154 (29%)
C17A2.3NP_494669.1 Galactosyl_T 98..>239 CDD:304462 42/138 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88734840
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.890

Return to query results.
Submit another query.