DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and C16D9.6

DIOPT Version :8

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_505126.2 Gene:C16D9.6 / 182687 WormBaseID:WBGene00015861 Length:340 Species:Caenorhabditis elegans

Alignment Length:331 Identity:107/332 (32%)
Similarity:165/332 (50%) Gaps:40/332 (12%)


  Fly     1 MGSLFSP--KKILQSQYTMILVMIRNIIFLVLGIMLGIRLTDFIGYLKLWRNNDLRA-------S 56
            :|||..|  ||:..|  |:.|.      ||:|..:|   :|.|:    |.|||..||       |
 Worm    28 LGSLKKPRNKKLFIS--TIALA------FLILAAIL---ITIFL----LTRNNSPRATYDRKNDS 77

  Fly    57 EKAALLKYPVASEEHLATWLRREVRILCLVLTMPSSHATKAALVNRTWGARCNK-LIFMSSQ-TD 119
            :...|::...|::.     |.::.::.|.|.|....|.|::..:|.||..||:. .:|.|.: .|
 Worm    78 KLLDLIEVSPAAQR-----LPKKGKLFCWVQTSTIYHDTRSLAINETWIHRCDHGQLFTSERFND 137

  Fly   120 SNLNILQINKS--ESRKNLYAKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPE 182
            :.:....:.|.  :...||:.|.|....:::.:..:|:||:|||||||::::||||.||...:|:
 Worm   138 TRIPYSTVFKGIPDDYYNLFFKSRYAFHHIYTNISSEFDWYLKADDDTFVIVENLRSFLSTLNPD 202

  Fly   183 SSVYFGCRFKAYFSQGYMSGGGGYVLSRDALRRLNLFALNSTTICKLNGESEDVQIGHCLQDVGV 247
            ...|.|...|.|...||.:||.||:|||.||:..:....::.|:|. :...|||.|..||.:.|:
 Worm   203 EPHYLGYVLKPYLKNGYNAGGAGYILSRAALKIFSEQLYSNATLCP-DDIYEDVGIARCLANAGM 266

  Fly   248 IAGDTRDFQGHHRFLPVNPFTVF-PTILSNSWLEGYFFHKPNKS-DCCAASAISFHYVKDFEFEL 310
            ...|||:..|.:||...:|...| .|.....|::    .|.||. :..|...||||.:...|..|
 Worm   267 YPEDTRNSLGQNRFNTFSPSDTFHQTKAGIDWVK----FKENKGYEAFANDLISFHKLSPDEIRL 327

  Fly   311 FEFFLY 316
            |:..||
 Worm   328 FDILLY 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 55/154 (36%)
C16D9.6NP_505126.2 Galactosyl_T 98..>250 CDD:304462 52/153 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88689700
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.