DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and C02H6.1

DIOPT Version :9

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_504891.1 Gene:C02H6.1 / 182129 WormBaseID:WBGene00015361 Length:334 Species:Caenorhabditis elegans


Alignment Length:333 Identity:87/333 - (26%)
Similarity:139/333 - (41%) Gaps:38/333 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FSPKKILQSQ------YTMILVMIRNII-------FLV---LGIMLGIRLTDFIGYLKLWRNNDL 53
            :|.:||...|      ||::|....::|       ||:   |.......:..:..|..|.||   
 Worm     3 YSMRKIESDQMDRIALYTLLLTFSLSLIVFPLYRNFLIPADLYTHFPAIIHPYREYYSLTRN--- 64

  Fly    54 RASEKAALLKYPVASEEHLATW-LRREVRILCLVLTMPSSHATKAALVNRTWGARC-NKLIFMSS 116
                   :.|.....|:..||: |....::.|.|.|.......:...:..||..|| |...|:.:
 Worm    65 -------VNKLTQGIEDSEATYDLPTSGQLFCFVETSKKYFNDRVPSMASTWLPRCDNGRFFLKT 122

  Fly   117 Q-TDSNLNILQI--NKSESRKNLYAKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYP 178
            . .|..:....:  |..:|..:|:.|......|.:.:...::||:||||||.|.::::|:.:|..
 Worm   123 PLVDEKIPFSTVYRNLEDSYYDLFRKTLLSFYYSYTYISKDFDWYLKADDDNYFMIDHLKEYLDT 187

  Fly   179 YDPESSVYFGCRFKAYFSQGYMSGGGGYVLSRDALRRLNLFALNSTTICKLNGESEDVQIGHCLQ 243
            .|....::.|.|.|.:...||.|||.||:||..|:|.......:....|..:. :||..|..||.
 Worm   188 LDASKPLFLGYRMKPFLEGGYNSGGAGYLLSNAAVRIFVEHLYHDEKRCPYDW-AEDRGIARCLA 251

  Fly   244 DVGVIAGDTRDFQGHHRFLPVNPFTVFPTILSNSWLEGYFFHKPNKSDCCAASAISFHYVKDFEF 308
            .:|::..||||..|..||||..| :..|.|     .|.|.::........:...||.|.:...:.
 Worm   252 SMGILPSDTRDNDGSCRFLPFRP-SEMPGI-----PEAYHYYPLKNGSFVSEKFISLHRISPRKM 310

  Fly   309 ELFEFFLY 316
            ...:..||
 Worm   311 IFLDSILY 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 43/153 (28%)
C02H6.1NP_504891.1 Galactosyl_T 83..>223 CDD:304462 40/139 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163266
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.