DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and C02H6.1

DIOPT Version :8

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_504891.1 Gene:C02H6.1 / 182129 WormBaseID:WBGene00015361 Length:334 Species:Caenorhabditis elegans

Alignment Length:333 Identity:87/334 (26%)
Similarity:139/334 (42%) Gaps:38/334 (11%)


  Fly     5 FSPKKILQSQ------YTMILVMIRNII-------FLV---LGIMLGIRLTDFIGYLKLWRNNDL 53
            :|.:||...|      ||::|....::|       ||:   |.......:..:..|..|.||   
 Worm     3 YSMRKIESDQMDRIALYTLLLTFSLSLIVFPLYRNFLIPADLYTHFPAIIHPYREYYSLTRN--- 64

  Fly    54 RASEKAALLKYPVASEEHLATW-LRREVRILCLVLTMPSSHATKAALVNRTWGARC-NKLIFMSS 116
                   :.|.....|:..||: |....::.|.|.|.......:...:..||..|| |...|:.:
 Worm    65 -------VNKLTQGIEDSEATYDLPTSGQLFCFVETSKKYFNDRVPSMASTWLPRCDNGRFFLKT 122

  Fly   117 Q-TDSNLNILQI--NKSESRKNLYAKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYP 178
            . .|..:....:  |..:|..:|:.|......|.:.:...::||:||||||.|.::::|:.:|..
 Worm   123 PLVDEKIPFSTVYRNLEDSYYDLFRKTLLSFYYSYTYISKDFDWYLKADDDNYFMIDHLKEYLDT 187

  Fly   179 YDPESSVYFGCRFKAYFSQGYMSGGGGYVLSRDALRRLNLFALNSTTICKLNGESEDVQIGHCLQ 243
            .|....::.|.|.|.:...||.|||.||:||..|:|.......:....|..:. :||..|..||.
 Worm   188 LDASKPLFLGYRMKPFLEGGYNSGGAGYLLSNAAVRIFVEHLYHDEKRCPYDW-AEDRGIARCLA 251

  Fly   244 DVGVIAGDTRDFQGHHRFLPVNPFTVFPTILSNSWLEGYFFHKPNKSDCCAASAISFHYVKDFEF 308
            .:|::..||||..|..||||..| :..|.|     .|.|.::........:...||.|.:...:.
 Worm   252 SMGILPSDTRDNDGSCRFLPFRP-SEMPGI-----PEAYHYYPLKNGSFVSEKFISLHRISPRKM 310

  Fly   309 ELFEFFLY 316
            ...:..||
 Worm   311 IFLDSILY 318

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 44/154 (29%)
C02H6.1NP_504891.1 Galactosyl_T 83..>223 CDD:304462 40/140 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88734851
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.