DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34057 and Y38C1AB.1

Sequence 1:NP_001033980.2 Gene:CG34057 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_499857.3 Gene:Y38C1AB.1 WormBaseID:WBGene00021403 Length:261 Species:Caenorhabditis elegans

Alignment Length:249 Identity:76/250 (30%)
Similarity:112/250 (45%) Gaps:28/250 (11%)


  Fly    82 ILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLN---------ILQINKSESRKNLY 137
            ||||:.|...||.|:|..:..||...|:..:|.   |||.:|         :|     .||.:.:
 Worm    22 ILCLIHTATPSHETRAKTILETWVQHCDDFLFF---TDSKMNDSIPHIYYPLL-----NSRDHSW 78

  Fly   138 AKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYFSQGYMSG 202
            .|:|....||......:|||:.:||||||.:|.|:|..|..|.|....|.|.::..:..:|: :.
 Worm    79 EKIRRVFKYVRDKITKKYDWYYRADDDTYALMHNMRTLLDNYSPTKHHYLGLQWNFFTPRGF-ND 142

  Fly   203 GGGYVLSRDALRRLNLFALNSTTICKLNGESEDVQIGHCLQDVGVIAGDTRDFQGHHR---FLPV 264
            |..|:|||..:...|...|:.......:...||.::..||..:.:...|.||..|..|   |.|:
 Worm   143 GSSYILSRPTMEAFNEVMLDPDRCPDHHRAEEDQELAKCLAHMEIYPEDIRDEMGSERIQHFHPL 207

  Fly   265 NPFTVFPTILSNSWLEGYFFHK--PNKSDCCAASAISFHYVKDFEFELFEFFLY 316
            ...|::.... |..|..|...|  .|.||    ..||||:|..:|..|.::..|
 Worm   208 EQLTIYKDTF-NRRLAYYPAMKEDENFSD----KMISFHHVSPYEMRLMDYIFY 256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 47/159 (30%)
Y38C1AB.1NP_499857.3 Galactosyl_T 33..>129 CDD:304462 34/104 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88689823
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.