DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34057 and W09D10.5

Sequence 1:NP_001033980.2 Gene:CG34057 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_499361.3 Gene:W09D10.5 WormBaseID:WBGene00012363 Length:321 Species:Caenorhabditis elegans

Alignment Length:323 Identity:76/324 (23%)
Similarity:132/324 (41%) Gaps:58/324 (18%)


  Fly    25 IIFLVLGIMLGIRLTDFIGYLKLW-RNNDLRASEKAALLKYPVASEEHLATWLRREVRILCLVLT 88
            :|.|.||:.||.    .||.|.:: .:||:  |:...|:::..::.:..:..||      |:::.
 Worm    18 VIHLALGVSLGY----LIGILFIFDGDNDI--SKHIHLMEHEKSTPKPESFNLR------CVIIL 70

  Fly    89 MPSSHATK--AALVNRTWGARCNKLIFMSSQTDSNLNILQINKSESRKNLYAKVRTGMAYVHKH- 150
            ..::|..:  .:.:...:...|.:.||.::      |....:|.:..:|.|.......:..|.: 
 Worm    71 HKATHKPENIISAITDGYAKLCQETIFFTN------NQKLFDKFQKFQNNYTMYHVDSSLNHFYW 129

  Fly   151 ----YLNEY------DWFLKADDDTYIVMENLRLFLYPYDPESSVYFG------CRFKAYF---S 196
                |..|:      .|....||.||:::.|||..|..:|.|..|..|      ..|...|   |
 Worm   130 TYYLYAMEFSSKVPAQWTFLGDDQTYLIVPNLRNTLRNFDSEKPVVLGKVKDTSTLFSWLFPLSS 194

  Fly   197 QGYMSGGGGYVLSRDALRRLNLFALNSTTICK--LNGESEDVQIGHCLQDVGVIAGDTRDFQGHH 259
            ...:|..||.|||..|:.:|        :.||  ....:.|..:..|.:..||...|..|.....
 Worm   195 FKKISVRGGVVLSNPAIDKL--------SACKGFFFSRASDFALYDCSEKYGVQIADPFDEDALR 251

  Fly   260 RFLPVNPFTVFPTILSNSWLEGYFFHKPNKSDCCAASAISFHYVKDFEFELFEFFLYYMRVFG 322
            .|..:.|..:   |..:|.|   |...|.|:..|:..||||..:.:.:..:.:|.: .::|||
 Worm   252 LFNDLPPKQI---IAPDSKL---FRSSPTKAGKCSDHAISFGQLSEKDMRVLQFGM-SLKVFG 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 39/174 (22%)
W09D10.5NP_499361.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.