DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and C38H2.2

DIOPT Version :8

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_499293.2 Gene:C38H2.2 / 176455 WormBaseID:WBGene00008019 Length:389 Species:Caenorhabditis elegans

Alignment Length:374 Identity:128/375 (34%)
Similarity:200/375 (53%) Gaps:59/375 (16%)


  Fly    25 IIFLVLGIMLGIRLT----------DFIGYLKLWR---------------NNDLRASEKA----- 59
            :.::.||::||:.::          |....:.:.|               .||....|:.     
 Worm    10 LAYVALGVLLGLTISIISQTGTTTYDAASRIAILRANRGDPQVDEHDHAHGNDPHGDEEVDDHHA 74

  Fly    60 --ALLKYPVASEEH-------LATWLRREVRILCLVLTMPSSHATKAALVNRTWGARCNKLIFMS 115
              |.:::...:..|       :|..:.::||:.|.:||...:|..:|..|..||..||||.:|||
 Worm    75 NFAPVQFHSNNSSHSHDGESLIADEVAKKVRVFCWILTGKQNHDKRAKHVKATWAKRCNKYVFMS 139

  Fly   116 SQTDSNLNILQINKSESRKNLYAKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYD 180
            |:.|:.|..:.:|.||.|..|:||.:....|::.|:||:||||||||||||:||||||..|..:.
 Worm   140 SEEDAELPAINLNVSEGRDYLWAKTKGAFKYIYDHHLNDYDWFLKADDDTYVVMENLRFMLLAHS 204

  Fly   181 PESSVYFGCRFKAYFSQGYMSGGGGYVLSRDALRRLNLFALNSTTICKLN-GESEDVQIGHCLQD 244
            |:..::|||:||.:...||.|||.||||||:||::....||...::|..| |.:||.::|.||:.
 Worm   205 PDEPIHFGCKFKPFTQGGYHSGGAGYVLSREALKKFIEVALPDKSLCSQNHGGAEDAEMGKCLEK 269

  Fly   245 VGVIAGDTRDFQGHHRFLP------VNPFTVFPTILSNSWLEGYFFHKPNKS-DCCAASAISFHY 302
            |||.|||:||..|||||:|      ::|..|.|..    |...|.::..::. .||:..|:||||
 Worm   270 VGVKAGDSRDADGHHRFMPFVPEHHLSPGHVDPKF----WFWQYTYYPMDQGPTCCSDYAVSFHY 330

  Fly   303 VKDFEFELFEFFLYYMRVFGLHRTPRALPSRLGFRQMNERLQHWSQQVT 351
            |......:.|:.:|:::.||:.|..| :|.       ||.:.|.:..::
 Worm   331 VNPNLMYVLEYLIYHLKPFGIDRAIR-VPK-------NETIIHTAYSIS 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 74/151 (49%)
C38H2.2NP_499293.2 Galactosyl_T 106..>274 CDD:304462 80/168 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88713422
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.