DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and LOC100486323

DIOPT Version :8

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_017947371.1 Gene:LOC100486323 / 100486323 -ID:- Length:254 Species:Xenopus tropicalis

Alignment Length:239 Identity:94/240 (39%)
Similarity:141/240 (59%) Gaps:6/240 (3%)


  Fly    87 LTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNILQINKSESRKNLYAKVRTGMAYVHKHY 151
            :|.|::..:||..:.|:|...||..:||||..:.....:.:...|.|:.||.|......|:|::|
 Frog     1 MTSPNNLQSKAIHLKRSWTRHCNITLFMSSTANETFPTIGLGTKEGREELYWKTIRAFQYIHQNY 65

  Fly   152 LNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYFSQGYMSGGGGYVLSRDALRR- 215
            |::.||||||||||::|||||:..|..|.||..:|.|.|||.:.:|||||||.|||||:::|:| 
 Frog    66 LDQADWFLKADDDTFVVMENLQFLLSNYTPEQPIYLGKRFKPFVNQGYMSGGAGYVLSKESLKRF 130

  Fly   216 LNLFALNSTTICKLNGESEDVQIGHCLQDVGVIAGDTRDFQGHHRFLPVNPFT-VFPTILSNSWL 279
            :..|   .|.:|......||:.:|.|::.:|||.||:||.:....|.|..|.| :.....::|..
 Frog   131 VEAF---RTGVCTHTSSIEDLALGQCMEKLGVIPGDSRDSEKRETFHPFTPETHIITRYTADSIY 192

  Fly   280 EGYFFHKPNKS-DCCAASAISFHYVKDFEFELFEFFLYYMRVFG 322
            .||.::...:. .||:..|||||||........|:|:|::|.:|
 Frog   193 WGYCYYPLIQGPQCCSDLAISFHYVPPELMYTLEYFVYHLRAYG 236

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 64/151 (42%)
LOC100486323XP_017947371.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D555141at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.