DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and LOC100486174

DIOPT Version :8

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_002933748.2 Gene:LOC100486174 / 100486174 -ID:- Length:335 Species:Xenopus tropicalis

Alignment Length:317 Identity:111/318 (35%)
Similarity:168/318 (53%) Gaps:36/318 (11%)


  Fly    26 IFLVLGIMLGIRLT----DFIGYLKL---------WRNNDLRASEKAALLKYPVASEEHLATWLR 77
            ::..||:::|..:|    :.:..|.:         |.||..          ..::...:::..|.
 Frog    15 LYFCLGLLVGFFMTLNMYNSVQELTISFNPPDPSQWDNNHF----------IHLSDNSNVSELLA 69

  Fly    78 REVRILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNILQINKSESRKNLYAKVRT 142
            |:||:||.::|.|.:...||..:.|:|...||..:||||..:.....:.:...|.|:.||.|...
 Frog    70 RKVRVLCWIMTSPKNLKKKAIHLKRSWARHCNITLFMSSTANEIFPTIGLGTKEGREELYWKTIR 134

  Fly   143 GMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYFSQGYMSGGGGYV 207
            ...|:|::||::.|||||||||||:|||||:..|..|.||..:|.|.|||.:.:|||||||.|||
 Frog   135 AFQYIHQNYLDQADWFLKADDDTYVVMENLQFLLSNYTPEQPIYLGKRFKPFVTQGYMSGGAGYV 199

  Fly   208 LSRDALRR-LNLFALNSTTICKLNGESEDVQIGHCLQDVGVIAGDTRDFQGHHRFLPVNPFTVFP 271
            ||:::|:| :..|   .|.:|......||:.:|.|::.:|||.||:||.:....|.|..|.|...
 Frog   200 LSKESLKRFVEAF---RTGVCTHTSSIEDLALGQCMEKLGVIPGDSRDSEKRETFHPFTPETHIT 261

  Fly   272 TILSNS----WLEGYF--FHKPNKSDCCAASAISFHYVKDFEFELFEFFLYYMRVFG 322
            :...|.    |...|:  ...|   .||:..|||||||......:.|:|:||:|.:|
 Frog   262 SDYINDFDDYWTYCYYPIIQGP---QCCSDLAISFHYVSPELMYMLEYFVYYLRAYG 315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 65/151 (43%)
LOC100486174XP_002933748.2 Galactosyl_T 92..>237 CDD:304462 64/148 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.