DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34039 and commd4

DIOPT Version :8

Sequence 1:NP_001034012.2 Gene:CG34039 / 3885643 FlyBaseID:FBgn0054039 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001307104.1 Gene:commd4 / 767771 ZFINID:ZDB-GENE-060929-600 Length:199 Species:Danio rerio

Alignment Length:200 Identity:71/200 (36%)
Similarity:112/200 (56%) Gaps:16/200 (8%)


  Fly     1 MKFRFCGEGDCPDWVLAEIISTLSNLSIENLEQLSDLVAQRICGETFEEAKIKSLTSTLTNEGKT 65
            |:|||||:.||||||||| ||||:.:|...::.|...|.:.:..|..:..|:..|||....:...
Zfish     1 MRFRFCGDLDCPDWVLAE-ISTLARISSVKMKLLCVQVVKDLLDEGIDYDKVSKLTSDAKFDSGD 64

  Fly    66 AVACI---NFMLTSAARYSCSESIFGEEIQQLGLPKDHAAAMCRVLQ-KHSATIRQTLINKSFRI 126
            ..|||   :|:|:|||::.........|:|||||||:|...:|:..: |||| :::.|...|.|:
Zfish    65 IKACIGVLSFILSSAAKHDVDSESLSSELQQLGLPKEHTTGLCKSYEDKHSA-LQEKLRESSLRL 128

  Fly   127 NELTSVR-----DISTPGQTPPNYATLELKISQE--LVDGLPKDTTHVLNIDRTQMKALLAELKL 184
            ..|.:|.     .:|:......|..|::|::..:  |.|.  .:|| |::|...:.:.||.|||.
Zfish   129 GRLQTVNWRVDYTLSSSELKQVNEPTVQLRLQAQDPLTDS--SETT-VVSITADKFRVLLTELKQ 190

  Fly   185 ARDVM 189
            |:::|
Zfish   191 AQNMM 195

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34039NP_001034012.2 HCaRG 23..190 CDD:284632 53/178 (30%)
commd4NP_001307104.1 Commd 25..198 CDD:297546 52/175 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140939428
eggNOG 1 0.900 E1_28K8D
Hieranoid 1 1.000
Homologene 1 1.000 H9865
Inparanoid 1 1.050 104 1.000 Inparanoid score I4859
OMA 1 1.010
OrthoDB 1 1.010 D1505629at2759
OrthoFinder 1 1.000 FOG0005079
OrthoInspector 1 1.000 T1051759
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR16231
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3436
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.900

Return to query results.
Submit another query.